| Basic Information | |
|---|---|
| Taxon OID | 3300006234 Open in IMG/M |
| Scaffold ID | Ga0082394_145112 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities, 1.1 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC366 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Yale Center for Genome Analysis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 752 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 28.3 | Long. (o) | -88.2 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030135 | Metagenome / Metatranscriptome | 186 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0082394_1451121 | F030135 | N/A | DFSEGLKDREELATLSSITDIGHSAYAGRQFPDAILPGREAVDLVAGPLN* |
| ⦗Top⦘ |