NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081460_1038625

Scaffold Ga0081460_1038625


Overview

Basic Information
Taxon OID3300006213 Open in IMG/M
Scaffold IDGa0081460_1038625 Open in IMG/M
Source Dataset NameCombined Assembly of all intestinal microbial_metagenomes from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Texas Southwestern Medical Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4492
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp. 26_22(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa

Source Dataset Sampling Location
Location NameUT Southwestern Medical Center, Dallas, Texas, USA
CoordinatesLat. (o)32.815891Long. (o)-96.846336Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013656Metagenome269Y

Sequences

Protein IDFamilyRBSSequence
Ga0081460_10386257F013656GGAGGVKKIYKTPNKSETETTINVLYGEERLTIYTNKVDLQKQLNKLLGEPTKELKIKRSIAGSIWEISFKEKSKISKVLLKANIYEL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.