Scaffold Ga0081460_1010780

Overview

Basic Information

• Taxon OID: 3300006213
• Scaffold ID: Ga0081460_1010780
• Source Dataset Name: Combined Assembly of all intestinal microbial_metagenomes from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Texas Southwestern Medical Center
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 12834
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (53.85%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa

Source Dataset Sampling Location

• Location Name: UT Southwestern Medical Center, Dallas, Texas, USA
• Coordinates
  • Lat. (^o): 32.815891
  • Long. (^o): -96.846336

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013656	Metagenome	269	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081460_10107809	F013656	AGGA	LEKRYKEPNRIEMETTINVLYEENVISIYTNKPDLQKQLCKSIGEPEKEFKKGKSILASRWKIPLNEKSKISKMMLKANIFQL*