Scaffold Ga0070765_100727715

Overview

Basic Information

• Taxon OID: 3300006176
• Scaffold ID: Ga0070765_100727715
• Source Dataset Name: Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 937
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_4_65_11 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location

• Location Name: USA: New Hampshire, Hubbard Brook experimental Forest
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063904	Metagenome / Metatranscriptome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070765_1007277152	F063904	N/A	EGDRAMNEKLIRMLIQYKDEFDRAPDNLSLGACTALLDLYIGRLTGCDIDEFGAIGILSAIYGLHDRRDPNRHSTKQLHMAVALARRAEHANAQIPAAA*