| Basic Information | |
|---|---|
| Taxon OID | 3300006169 Open in IMG/M |
| Scaffold ID | Ga0082029_1620134 Open in IMG/M |
| Source Dataset Name | Termite nest microbial communities from Madurai, India |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | BGI Tech Solutions Co., Ltd. |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 628 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest → Termite Nest Microbial Communities From Madurai, India |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | MKU,India | |||||||
| Coordinates | Lat. (o) | 9.941418 | Long. (o) | 78.008896 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042550 | Metagenome / Metatranscriptome | 158 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0082029_16201342 | F042550 | GGAGG | VTILMSLLGTKALGLFMLLQEAAASPAEGNAATQFTLTEMVK |
| ⦗Top⦘ |