| Basic Information | |
|---|---|
| Family ID | F042550 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 158 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VTILTSILGTKALGLLLLLQEAAASPEASGADHFTLTEMVKNMGGVAIA |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.89 % |
| % of genes near scaffold ends (potentially truncated) | 99.37 % |
| % of genes from short scaffolds (< 2000 bps) | 96.20 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.304 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (9.494 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.975 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.291 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF03544 | TonB_C | 96.20 |
| PF02355 | SecD_SecF | 2.53 |
| PF02699 | YajC | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 96.20 |
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 2.53 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 2.53 |
| COG1862 | Protein translocase subunit YajC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.30 % |
| Unclassified | root | N/A | 5.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_12365378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 530 | Open in IMG/M |
| 3300003319|soilL2_10030554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1022 | Open in IMG/M |
| 3300003324|soilH2_10080300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1546 | Open in IMG/M |
| 3300003998|Ga0055472_10071943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300004153|Ga0063455_100442001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300004463|Ga0063356_105011295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300004643|Ga0062591_102306439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300004798|Ga0058859_11765126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300004800|Ga0058861_11934283 | Not Available | 1292 | Open in IMG/M |
| 3300004801|Ga0058860_12070404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1228 | Open in IMG/M |
| 3300004803|Ga0058862_12857482 | Not Available | 1329 | Open in IMG/M |
| 3300005093|Ga0062594_100771563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300005288|Ga0065714_10520064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300005293|Ga0065715_10260777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
| 3300005295|Ga0065707_10002147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 7495 | Open in IMG/M |
| 3300005328|Ga0070676_10189864 | Not Available | 1341 | Open in IMG/M |
| 3300005328|Ga0070676_11558441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300005330|Ga0070690_100077322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2172 | Open in IMG/M |
| 3300005330|Ga0070690_100498572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300005334|Ga0068869_100223470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1493 | Open in IMG/M |
| 3300005334|Ga0068869_101186213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 670 | Open in IMG/M |
| 3300005338|Ga0068868_102206442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005340|Ga0070689_100629701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 931 | Open in IMG/M |
| 3300005341|Ga0070691_10712227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300005343|Ga0070687_100605074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300005343|Ga0070687_100679731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300005344|Ga0070661_101276276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300005344|Ga0070661_101759298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300005345|Ga0070692_10482456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300005354|Ga0070675_101727103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300005365|Ga0070688_101379937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300005440|Ga0070705_101672905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300005444|Ga0070694_100707359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 820 | Open in IMG/M |
| 3300005457|Ga0070662_100202489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
| 3300005466|Ga0070685_10826459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300005466|Ga0070685_11428282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300005468|Ga0070707_100304416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1549 | Open in IMG/M |
| 3300005471|Ga0070698_101740776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300005530|Ga0070679_101073246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300005535|Ga0070684_101432384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 651 | Open in IMG/M |
| 3300005539|Ga0068853_101679085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300005539|Ga0068853_101836338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300005545|Ga0070695_100293787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300005546|Ga0070696_100244425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1355 | Open in IMG/M |
| 3300005546|Ga0070696_100453215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1013 | Open in IMG/M |
| 3300005564|Ga0070664_100540346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
| 3300005577|Ga0068857_100431074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1230 | Open in IMG/M |
| 3300005578|Ga0068854_100832211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300005615|Ga0070702_100373080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300005615|Ga0070702_100620337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300005617|Ga0068859_100105841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2872 | Open in IMG/M |
| 3300005617|Ga0068859_102845615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300005618|Ga0068864_102491160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300005719|Ga0068861_100447478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300005840|Ga0068870_10169222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1303 | Open in IMG/M |
| 3300005841|Ga0068863_101181797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300005843|Ga0068860_102513413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300005844|Ga0068862_100290365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1501 | Open in IMG/M |
| 3300005844|Ga0068862_100577388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1076 | Open in IMG/M |
| 3300005873|Ga0075287_1005880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1451 | Open in IMG/M |
| 3300006169|Ga0082029_1620134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300006173|Ga0070716_101156186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300006804|Ga0079221_10464126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300006844|Ga0075428_100324563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1654 | Open in IMG/M |
| 3300006853|Ga0075420_101349634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300006871|Ga0075434_102204463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300006876|Ga0079217_10141436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1150 | Open in IMG/M |
| 3300006876|Ga0079217_10676778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300006880|Ga0075429_101032067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 719 | Open in IMG/M |
| 3300006881|Ga0068865_100807846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300006881|Ga0068865_101034492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300006904|Ga0075424_101249767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300006904|Ga0075424_102577179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300006954|Ga0079219_10645124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300006969|Ga0075419_11107140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300007076|Ga0075435_100062923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3012 | Open in IMG/M |
| 3300009011|Ga0105251_10508383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300009088|Ga0099830_11755860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300009093|Ga0105240_12217821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300009168|Ga0105104_10174663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1165 | Open in IMG/M |
| 3300009174|Ga0105241_11287826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300009840|Ga0126313_11241169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300010040|Ga0126308_10816318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300010041|Ga0126312_10563156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300010041|Ga0126312_11374608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300010042|Ga0126314_11088249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 595 | Open in IMG/M |
| 3300010043|Ga0126380_11954360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 535 | Open in IMG/M |
| 3300010045|Ga0126311_10119846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1834 | Open in IMG/M |
| 3300010047|Ga0126382_12544615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300010358|Ga0126370_10417032 | Not Available | 1108 | Open in IMG/M |
| 3300010362|Ga0126377_11328614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300010373|Ga0134128_10646714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1175 | Open in IMG/M |
| 3300010373|Ga0134128_10871945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300010375|Ga0105239_13112197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300010399|Ga0134127_11380430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300010399|Ga0134127_13037528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 547 | Open in IMG/M |
| 3300010403|Ga0134123_11256674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300011119|Ga0105246_10944724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300011993|Ga0120182_1024572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300012354|Ga0137366_10182706 | Not Available | 1572 | Open in IMG/M |
| 3300012509|Ga0157334_1037259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300012929|Ga0137404_10763596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300012948|Ga0126375_11514740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300012955|Ga0164298_10157255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1284 | Open in IMG/M |
| 3300012958|Ga0164299_11176464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300012961|Ga0164302_11230146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300012984|Ga0164309_10202759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1365 | Open in IMG/M |
| 3300013100|Ga0157373_10786352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300014326|Ga0157380_10813422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300015372|Ga0132256_101821754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300015374|Ga0132255_105997576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 514 | Open in IMG/M |
| 3300018466|Ga0190268_12064056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300019377|Ga0190264_12066229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300021445|Ga0182009_10164576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
| 3300025885|Ga0207653_10272849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300025907|Ga0207645_10195269 | Not Available | 1331 | Open in IMG/M |
| 3300025911|Ga0207654_11233387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 545 | Open in IMG/M |
| 3300025927|Ga0207687_10883495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300025934|Ga0207686_11694605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300025939|Ga0207665_10052948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2735 | Open in IMG/M |
| 3300025941|Ga0207711_11511764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300025942|Ga0207689_11327211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300025942|Ga0207689_11337809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300025945|Ga0207679_10284136 | Not Available | 1420 | Open in IMG/M |
| 3300025981|Ga0207640_10925365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300026041|Ga0207639_10266904 | Not Available | 1499 | Open in IMG/M |
| 3300026075|Ga0207708_10333498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300026088|Ga0207641_10788662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300026095|Ga0207676_12570465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300026116|Ga0207674_10679498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300026680|Ga0208345_102826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300026704|Ga0208581_103845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300026900|Ga0207444_1017156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300027691|Ga0209485_1257722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300027875|Ga0209283_10636389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300027909|Ga0209382_10574890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1231 | Open in IMG/M |
| 3300028380|Ga0268265_10779468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
| 3300028380|Ga0268265_11403526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300028802|Ga0307503_10798432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300030496|Ga0268240_10142051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 587 | Open in IMG/M |
| 3300030499|Ga0268259_10129935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300031058|Ga0308189_10337384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300031547|Ga0310887_10127717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
| 3300031740|Ga0307468_101294009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300031740|Ga0307468_101786054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031824|Ga0307413_10509095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300031892|Ga0310893_10434275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300031908|Ga0310900_11175675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300031944|Ga0310884_10795973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300031962|Ga0307479_10285719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1631 | Open in IMG/M |
| 3300031996|Ga0308176_12510509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300032002|Ga0307416_102370522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300032005|Ga0307411_11691313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300032211|Ga0310896_10495602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300033412|Ga0310810_11369105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300034479|Ga0314785_025257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300034659|Ga0314780_133323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.06% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 5.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.06% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.43% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.16% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.16% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.53% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 2.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.27% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.63% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.63% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.63% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026680 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized - NN609 (SPAdes) | Environmental | Open in IMG/M |
| 3300026704 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized - NN606 (SPAdes) | Environmental | Open in IMG/M |
| 3300026900 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034479 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_123653781 | 3300000953 | Soil | MSLFGTKAIGLFLLLQDAAAGASPEASSADHFTLTEMVKNMGGVAIAVVIVLLIMSVYS |
| soilL2_100305541 | 3300003319 | Sugarcane Root And Bulk Soil | VTILTSLLGAKALGLLLLFQEAAASPAADAGNTFTLTEMVKNMGGVAI |
| soilH2_100803003 | 3300003324 | Sugarcane Root And Bulk Soil | VTILTSLLGTKAFGLLMFLQEAAASPESSGADHFTLTEMVKNM |
| Ga0055472_100719432 | 3300003998 | Natural And Restored Wetlands | LEGFTVTILTSLLGTKALGLLLLLQEATASPQTADHFTLTEMV |
| Ga0063455_1004420011 | 3300004153 | Soil | VTMLTSIFIGFLMLLQDAAASPAASDADHFTLTEMVKNMGGVAIAVVI |
| Ga0063356_1050112952 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LEGFTVTILTSLLGAKALGLFLLFQEAAASPAADTGNTFTL |
| Ga0062591_1023064392 | 3300004643 | Soil | LEGFTVTILTSLFGTKVLGLLLLLQEAAASPSAGENAANTFTLT |
| Ga0058859_117651261 | 3300004798 | Host-Associated | VTMLISLFGTKVLGLFMLLQEAAASPEASGADHFTLTEMVKNMGGVAIAV |
| Ga0058861_119342831 | 3300004800 | Host-Associated | VTILTSILGTKVLGLFLLLQEAAAAASPGASDADHFTLTEMVKNMGGVAI |
| Ga0058860_120704041 | 3300004801 | Host-Associated | VTILMSLLGTKALGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGG |
| Ga0058862_128574822 | 3300004803 | Host-Associated | VTILMSLFGTKALGLLMLLQEAAASPAEGANTANTFTLTEMVK |
| Ga0062594_1007715631 | 3300005093 | Soil | VTMLISLFGTKALGLLMLLQDAATSPEASSADHFTLTEMVKNMGGVAIAVVIVLL |
| Ga0065714_105200642 | 3300005288 | Miscanthus Rhizosphere | VTMLISLFGTKVLGLFMLLQEAAASPAQDTGNTFTLTEMV |
| Ga0065715_102607772 | 3300005293 | Miscanthus Rhizosphere | VTMLISLFGTKALGLLMLLQEAATSPETSSADHFTLTEMVKN |
| Ga0065707_100021477 | 3300005295 | Switchgrass Rhizosphere | VTILTSLLGTKALGLLLFLQDAAASPEASGADHFTLTEMVKNMGGVAIAVVIVLLIMSVY |
| Ga0070676_101898641 | 3300005328 | Miscanthus Rhizosphere | VTILTSILGTKALGLLLLLQEAAAATSPEASGADHFTLTEMVKNMGGVAIAVV |
| Ga0070676_115584411 | 3300005328 | Miscanthus Rhizosphere | VTILTSLLGAKALGLFLLFQEAAASPAADTGNTFTLTEMVKNMGGVAIAVVIV |
| Ga0070690_1000773221 | 3300005330 | Switchgrass Rhizosphere | LEGFIVTILTSLLGTKVLGVVIFLLQEAAASPAASPAAAGH |
| Ga0070690_1004985722 | 3300005330 | Switchgrass Rhizosphere | VTILTSIFLGFLMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIVLL |
| Ga0068869_1002234701 | 3300005334 | Miscanthus Rhizosphere | VTMLISLFGTKVLGLFMLLQEAAASPEASGADHFTLTEMV |
| Ga0068869_1011862131 | 3300005334 | Miscanthus Rhizosphere | VTILMSLLGTKALGLFMLLQEAAASPAEGANAATQFTLTEMVKNMGGVAIAVVIVLLIMSVYS |
| Ga0068868_1022064422 | 3300005338 | Miscanthus Rhizosphere | VTMLTSIFIGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVLLIMSVY |
| Ga0070689_1006297012 | 3300005340 | Switchgrass Rhizosphere | VTILTSIFLGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVLLIMSV |
| Ga0070691_107122271 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VTILTSLFGTKILGLMLFLQEAAASPDASASTNQFTLTEMVKNMGGVAI |
| Ga0070687_1006050741 | 3300005343 | Switchgrass Rhizosphere | VTMLTSIFVGFLMLLQEAAASPEASNANQFTLTEMVKNMGGVAIAVVIVLLIMSV |
| Ga0070687_1006797312 | 3300005343 | Switchgrass Rhizosphere | VTMLMSIFGTKILGLFVLLQDAAAAASPEAGTGDHFTLTEMVKNMGGVAIAV |
| Ga0070661_1012762761 | 3300005344 | Corn Rhizosphere | LEGFTVTMLISLFGTKVLGLFMLLQEAAASPAEGANAANTFTLT |
| Ga0070661_1017592981 | 3300005344 | Corn Rhizosphere | VTILMSLFGTKAIGLLMLLQDAAASPAEGANAATQFTLTEMVKNMGGVAIAVVI |
| Ga0070692_104824561 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VTMLMSIFGTKVLGLMLLLQEAAASPESSGADHFTLTEMVKNMGGVAIAVV |
| Ga0070675_1017271032 | 3300005354 | Miscanthus Rhizosphere | VTILTSLLGMKAFGLLMFLQEAAASPESSGADHFTLTEMVKNMGGV |
| Ga0070688_1013799371 | 3300005365 | Switchgrass Rhizosphere | VTILTSILGTKALGLLLLLQEAAASPEASGADHFTLTEMVKNMGGVAIA |
| Ga0070705_1016729051 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGV |
| Ga0070694_1007073592 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VTMLISLFGTKVLGLFMLLQEAAASPEASGADHFTLTEMVKNMGGVAIAVVIVLLIMSVY |
| Ga0070662_1002024893 | 3300005457 | Corn Rhizosphere | VTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVAIAV |
| Ga0070685_108264591 | 3300005466 | Switchgrass Rhizosphere | VTILMSLFGTKAIGLLMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAI |
| Ga0070685_114282821 | 3300005466 | Switchgrass Rhizosphere | MSLFGTKAIGLLMLLQDAAASPAEGANAATQFTLTEMVKNMGGVAIAVVIVLLI |
| Ga0070707_1003044163 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VTMLMSIFGTKVLGLMLLLQEAAASPESSGADHFTLTEMVKNMGGVAIAVVIV |
| Ga0070698_1017407762 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VTILMSLLGTKVLGLFMLLQEAAASPAAESSANTFTLTEMVKNMGGVAIAVVIVL |
| Ga0070679_1010732462 | 3300005530 | Corn Rhizosphere | VTILTSLLGMKAFGLLMFLQEAAASPESSGADHFTLTEMVKNMGGVAIAVV |
| Ga0070684_1014323841 | 3300005535 | Corn Rhizosphere | VTMLTSIFIGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVLLIMSVYS |
| Ga0068853_1016790851 | 3300005539 | Corn Rhizosphere | VTILTSLFGTKILGLMLFLQEAAASPDASASTNQFTLTEMVKNMGG |
| Ga0068853_1018363382 | 3300005539 | Corn Rhizosphere | VTILTSILGTKVLGLFLLLQEAAAAASPGASDADHFTLTEMVKNMGGVAIAVVIVLL |
| Ga0070695_1002937872 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVAIAVVI |
| Ga0070696_1002444251 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VTMLMSIFGTKVLGLMLLLQEAAASPESSGADHFTLTEMVKNMGGVAIAVVIVL |
| Ga0070696_1004532151 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VTILTSIFLGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVLLIMSVYS |
| Ga0070664_1005403461 | 3300005564 | Corn Rhizosphere | VTILTSFLGIKALGLLMLFQEAAASPAADTGNTFTLTEMVKNMGGVAI |
| Ga0068857_1004310743 | 3300005577 | Corn Rhizosphere | VTILTSLLGTKAFGLLMFLQEAAASPESSGADHFTLTEM |
| Ga0068854_1008322112 | 3300005578 | Corn Rhizosphere | VTMLISLFGTKVLGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAI |
| Ga0070702_1003730803 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VTILTSLFGAKALGLFLLLQEAAASPEASNANQFTLTEMVKNMG |
| Ga0070702_1006203372 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLFGTKVFGLLLLLQEAAASPEASSADHFTLTEMVKNMGGVAI |
| Ga0068859_1001058411 | 3300005617 | Switchgrass Rhizosphere | VTILMSLLGTKALGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAVVIVLLIM |
| Ga0068859_1028456152 | 3300005617 | Switchgrass Rhizosphere | VTMLMSLFGTKVVGLFMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIV |
| Ga0068864_1024911602 | 3300005618 | Switchgrass Rhizosphere | VTILMSLFGTKVLGLFMLLQDAAASPEASSADHFTLTEMVKN |
| Ga0068861_1004474781 | 3300005719 | Switchgrass Rhizosphere | VTILMSLFGTKAIGLLMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAV |
| Ga0068870_101692223 | 3300005840 | Miscanthus Rhizosphere | VTILTSIFLGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVL |
| Ga0068863_1011817972 | 3300005841 | Switchgrass Rhizosphere | VTILMSLLGTKALGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAVVIVLLIMS |
| Ga0068860_1025134132 | 3300005843 | Switchgrass Rhizosphere | VTILMSLLGTKALGLFMLLQEAAASPAEGANAATQFTLTEMVKNMGGVAIAVVIV |
| Ga0068862_1002903651 | 3300005844 | Switchgrass Rhizosphere | VTILMSVFGTKVLGLLLLLQEAAASPETSSADHFTLTEMVKNMGG |
| Ga0068862_1005773881 | 3300005844 | Switchgrass Rhizosphere | VTILMSLFGTKAIGLLMLLQDAAASPAEGANAATQFTLTEMV |
| Ga0075287_10058802 | 3300005873 | Rice Paddy Soil | VTMLTSIFIGFLMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIVLLIMS |
| Ga0082029_16201342 | 3300006169 | Termite Nest | VTILMSLLGTKALGLFMLLQEAAASPAEGNAATQFTLTEMVK |
| Ga0070716_1011561862 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VTILMSLFGTKALGLLMLLQEAAASPAEGANTANTFTLTEMVKNMGGVAIAVV |
| Ga0079221_104641262 | 3300006804 | Agricultural Soil | VTILTSLLGAKALGLLLLFQEAAASPAADTGSTFTLTEMVKNMGGVAIAGVI |
| Ga0075428_1003245631 | 3300006844 | Populus Rhizosphere | VTMLISIFGTKALGLLMLLQEAAASPESSGADHFTLTEMVKNMGGVAIAVVVV |
| Ga0075420_1013496342 | 3300006853 | Populus Rhizosphere | VTILTSLLGTKALGLLLFLQDAAASPEASGADHFTLTEMVKNMGGVAIAV |
| Ga0075434_1022044631 | 3300006871 | Populus Rhizosphere | VTILMSLFGTKALGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAI |
| Ga0079217_101414363 | 3300006876 | Agricultural Soil | VTMLMSVFGTKVLGLLVLLQDAAASPESSGADHFTLTEMVKNMG |
| Ga0079217_106767781 | 3300006876 | Agricultural Soil | VTMLMSLFGTKFLSFMLLLQDAAASTEAAGADHFSLTAMIKSMGAVAIAVVLV |
| Ga0075429_1010320671 | 3300006880 | Populus Rhizosphere | VTILISLFGTKALGFLMLLQEAAATEATGADHFSLTEMVKSMGGVAIAVVVVLLIMSVYS |
| Ga0068865_1008078461 | 3300006881 | Miscanthus Rhizosphere | VTILTSIFLGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVLLIMS |
| Ga0068865_1010344922 | 3300006881 | Miscanthus Rhizosphere | VTILTSLFGLLLLLQEAAASPEAGASSANTFTLTEMVKNMGGVAIAV |
| Ga0075424_1012497671 | 3300006904 | Populus Rhizosphere | VTILTSLLGTKALGLLIFLQEAAQPGASPGGEAANTFTITEMVKNMGGVA |
| Ga0075424_1025771792 | 3300006904 | Populus Rhizosphere | VTILTSLFGILLLLQEAAASPEGASNANQFTLTEMVK |
| Ga0079219_106451242 | 3300006954 | Agricultural Soil | VTILTSLLGAKALGLLLLFQEAAASPAADTGNTFTLT |
| Ga0075419_111071401 | 3300006969 | Populus Rhizosphere | VTILTSLLGTKALGLLLLLQEAAASPEGASAQNTFT |
| Ga0075435_1000629235 | 3300007076 | Populus Rhizosphere | VTILMSLLGTKVLGLFMLLQEAAASPAAESSANTFTLTEMVKNMGGV |
| Ga0105251_105083831 | 3300009011 | Switchgrass Rhizosphere | MSLFGTKVLGLLMLLQDAAASPSEGANAANTFTLTEMVKNMGGVAI |
| Ga0099830_117558601 | 3300009088 | Vadose Zone Soil | LEGFAVTILTSLLGTKALGLVIFLLQAAEASPAGSPKASNDQFALTEMVKNMGAVAIGVVIVL |
| Ga0105240_122178212 | 3300009093 | Corn Rhizosphere | MSLFGTKALGLLMLLQEAAASPAEGANTANTFTLT |
| Ga0105104_101746631 | 3300009168 | Freshwater Sediment | LEGFTVTILTSLLGTKAFGLLLLLQEAAASPEGSTGADHFSLTEM |
| Ga0105241_112878262 | 3300009174 | Corn Rhizosphere | MSLLGTKALGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAI |
| Ga0126313_112411692 | 3300009840 | Serpentine Soil | MSIFGTKALGLFMLLQEAAASPEASSADHFTLTEMVKN |
| Ga0126308_108163182 | 3300010040 | Serpentine Soil | LEGFTVTILMSLFGTKALGLFMLLQEAAASPEASGADHFTLTEMVKN |
| Ga0126312_105631561 | 3300010041 | Serpentine Soil | VTILTSLLGTKAFGLLMLLQEAAASPEASGADHFTLTEMV |
| Ga0126312_113746081 | 3300010041 | Serpentine Soil | MSVFGTKVLGLLLLLQEAAASPEASGADHFTLTEMVKNMGGVA |
| Ga0126314_110882492 | 3300010042 | Serpentine Soil | MSLFGTKALGLLMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAVVIVLLIM |
| Ga0126380_119543601 | 3300010043 | Tropical Forest Soil | MLISLLGTKALGLFLLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAVVIVLLIMSVY |
| Ga0126311_101198461 | 3300010045 | Serpentine Soil | MKAFGLLMLLQEAAASPEASGADHFTLTEMVKNMGG |
| Ga0126382_125446151 | 3300010047 | Tropical Forest Soil | LEGFTVTILTSLLGSKALGLLLMFQEAQAAASPATENQFTITEMVKNMGG |
| Ga0126370_104170321 | 3300010358 | Tropical Forest Soil | MSLFGTKTLGLLLLLQEAAASPAEGANTANTFTLTEMVKN |
| Ga0126377_113286141 | 3300010362 | Tropical Forest Soil | VTILTSLLGTKALGLLILFQEAAASPEASSADHFTLTEM |
| Ga0134128_106467142 | 3300010373 | Terrestrial Soil | LEGFTVTILTSLFGTKVLGLLLFLQEAAASPEGGGGADHFTLTEMVKNMGGVAIAVVIVLLI |
| Ga0134128_108719451 | 3300010373 | Terrestrial Soil | MSLFGTKALGLLMLLQEAAASPAEGANTANTFTQAEMVKN |
| Ga0105239_131121972 | 3300010375 | Corn Rhizosphere | MLISLFGTKALGLLMLLQEAATSPEASSADHFTLTE |
| Ga0134127_113804302 | 3300010399 | Terrestrial Soil | MLMSLFGTKVVGLFMLLQEAAASPEASSADHFTLTEMVKNM |
| Ga0134127_130375281 | 3300010399 | Terrestrial Soil | LEGFTVTILTSLFGTKILGLMLFLQEAAASPDASASTNQFTLTEMVKNMGGVAIAVVVVLLIMSVYS |
| Ga0134123_112566741 | 3300010403 | Terrestrial Soil | MLTSIFIGFLMLLQEAAASPEASNADHFTLTEMVKNMGGVAIAVVIVLLIMSVYSI |
| Ga0105246_109447241 | 3300011119 | Miscanthus Rhizosphere | MSLLGTKALGLFILLQEAATSPAEGADANHFTLTEMVKNMG |
| Ga0120182_10245721 | 3300011993 | Terrestrial | VTMLISLFGTKAFGLLMLLQEAATSPEATGADHFSLT |
| Ga0137366_101827063 | 3300012354 | Vadose Zone Soil | VTILTSLLGTKALGLFFMLQEAAPAASPATDQNTFTMSEMVKNMGPVAIC |
| Ga0157334_10372591 | 3300012509 | Soil | LEGFTVTILTSILGTKVLGLFLLLQEAAAAASPGASDADHFTLTEMVKNMGGVAIAVVIV |
| Ga0137404_107635962 | 3300012929 | Vadose Zone Soil | LEGFTVSILTSLLGTKAIVLLFMLQDATAAASPGTDTSNTFTMSEMVKNMGPVAIAVV |
| Ga0126375_115147401 | 3300012948 | Tropical Forest Soil | MSLFGTKALGLLMLLQEAAASPAEGANAAQTFTLTEMVK |
| Ga0164298_101572551 | 3300012955 | Soil | MSLFGAKVLGLFMLLQEAAASPEASSADHFTLTEM |
| Ga0164299_111764642 | 3300012958 | Soil | MLTSIFIGFLMLLQEAAASPAASDADYFTLTEMVTHSGGVAIAVVI |
| Ga0164302_112301462 | 3300012961 | Soil | VTILTSLFGLLLLLQEAAASPEAAASSANTFTLTEMVK |
| Ga0164309_102027592 | 3300012984 | Soil | VTILTSLLGTKAFGLLLLLQDAAATPEASGADHFT |
| Ga0157373_107863521 | 3300013100 | Corn Rhizosphere | MSLFGTKAIGLLMLLQEAAASPEASSADHFTLTEMVKNM |
| Ga0157380_108134221 | 3300014326 | Switchgrass Rhizosphere | MLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVAIAVVIV |
| Ga0132256_1018217541 | 3300015372 | Arabidopsis Rhizosphere | MLISLFGTKALGLFMLLQEAAASPEASGADHFTLTEMVKNMGGVAIAVVIVL |
| Ga0132255_1059975762 | 3300015374 | Arabidopsis Rhizosphere | LEGFTVTILTSLFGVKALGLLLLLQDAAASPEASSANTFTLTEMVKNMGGVAIAVVIVLLIMSVY |
| Ga0190268_120640562 | 3300018466 | Soil | VTMLISLFGTKALGLLLLLQEAAASPESSGADHFSLTEMVKSMGG |
| Ga0190274_105679122 | 3300018476 | Soil | VTILTSLFGTKALGLLLFLQEAAGAEGGAGAGDHFSLTE |
| Ga0190264_120662291 | 3300019377 | Soil | VTMLMSIFGTKFLSFMLLLQDAAAAGTEATGADHFSLTGMIKSMGG |
| Ga0182009_101645762 | 3300021445 | Soil | VTILTSFLGILLFFQEQAASPAADTGTQFTLTEMVKNMGGVAIAVVIVLLIM |
| Ga0207653_102728492 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VTILTSIFLGFLMLLQEAAASPEASSADHFTLTEMVKNMG |
| Ga0207645_101952692 | 3300025907 | Miscanthus Rhizosphere | VTILTSILGTKALGLLLLLQEAAAATSPEASGADHFTLTEMVKNMGGV |
| Ga0207654_112333872 | 3300025911 | Corn Rhizosphere | VTMLMSLFGTKVVGLFMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIVLLIMSV |
| Ga0207687_108834951 | 3300025927 | Miscanthus Rhizosphere | VTILTSLFGAKALGLLLLLQEAAASPEASNANQFTLTEMVKNMGGVAIAVVI |
| Ga0207686_116946052 | 3300025934 | Miscanthus Rhizosphere | VTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVAIAVVIVL |
| Ga0207665_100529484 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VTILTSLLGAKALGLLLLFQEAAASPAAADTGNTFTLTEMVKNMGGVAIAVVIVLLIMSV |
| Ga0207711_115117642 | 3300025941 | Switchgrass Rhizosphere | VTMLISLFGTKVLGLFMLLQEAAASPAEGANAANTFTLTEM |
| Ga0207689_113272112 | 3300025942 | Miscanthus Rhizosphere | VTMLISLFGTKVLGLFMLLQEAAASPEASGADHFTLTEMVKNM |
| Ga0207689_113378091 | 3300025942 | Miscanthus Rhizosphere | VTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVAIAVVIVLLI |
| Ga0207679_102841361 | 3300025945 | Corn Rhizosphere | VTILTSLFGTKILGLMLFLQEAAASPDASASTNQFTLTEMVKNMGGVAIAVVVVLL |
| Ga0207640_109253651 | 3300025981 | Corn Rhizosphere | VTMLISLFGTKVLGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAVVIVL |
| Ga0207639_102669042 | 3300026041 | Corn Rhizosphere | VTILTSILGTKALGLLLLLQEAAASPEASGADHFTL |
| Ga0207708_103334981 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVA |
| Ga0207641_107886622 | 3300026088 | Switchgrass Rhizosphere | VTMLMSLFGTKALGLLLLLQDAAASPAEGAGANAA |
| Ga0207676_125704651 | 3300026095 | Switchgrass Rhizosphere | VTILTSIFLGFLMLLQEAAASPEASSADHFTLTEMVKNMGGVAIA |
| Ga0207674_106794982 | 3300026116 | Corn Rhizosphere | VTILTSLFGTKILGLMLFLQEAAASPDASASTNQFTLTEMVKNMGGVAIA |
| Ga0208345_1028261 | 3300026680 | Soil | VTILTSIFLGFLMLLQDAAASPEASSADHFTLTEMVKNM |
| Ga0208581_1038452 | 3300026704 | Soil | VTILTSIFLGFLMLLQDAAASPEASSADHFTLTEMVKNMGG |
| Ga0207444_10171562 | 3300026900 | Soil | VTILTSLLGAKALGLFLLFQDAAASPAADTGSQFTLTEMVKNMGGV |
| Ga0209485_12577222 | 3300027691 | Agricultural Soil | VTMLMSLFGTKFLSFMLLLQDAAASTEAAGADHFSLTAMIKSMGAVAIAVV |
| Ga0209283_106363892 | 3300027875 | Vadose Zone Soil | VTILTSILGTKALGLLVFLWQASPAASPPANTLRID |
| Ga0209382_105748902 | 3300027909 | Populus Rhizosphere | VTILMSLFGTKALGLFMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIVLLIMS |
| Ga0268265_107794681 | 3300028380 | Switchgrass Rhizosphere | VTILMSVFGTKVLGLLLLLQEAAASPETSSADHFTL |
| Ga0268265_114035262 | 3300028380 | Switchgrass Rhizosphere | VTMLISLFGTKVLGLFMLLQEAAASPEASGADHFTLTEMVKNMGGVAI |
| Ga0307503_107984321 | 3300028802 | Soil | VTILTSLLGTKALGLLLFLQEAAASPEGGGGADHF |
| Ga0268240_101420512 | 3300030496 | Soil | VTMLMSLFGTKVIGLMLWLQDAAATGSPEAGTGDHFTLTEMVKNMGGVAIAVVIVLLIMSVYS |
| Ga0268259_101299351 | 3300030499 | Agave | VTMLMSLFGTKFLSFMLLLQEAAAGTEATGADHFSLTGMIKSMGGVAIAV |
| Ga0308189_103373842 | 3300031058 | Soil | VTILTSLLGTKALGLLYFLQDAAAAPSPGTDTTNAFSMTEMFKHMGPVGL |
| Ga0310887_101277172 | 3300031547 | Soil | VTILTSLLGTKALGLLLFLQDAAASPEASGADHFTLTEMVKNMGGV |
| Ga0307468_1012940091 | 3300031740 | Hardwood Forest Soil | VTILMSLFGTKVLGLFVLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIVLLIMS |
| Ga0307468_1017860542 | 3300031740 | Hardwood Forest Soil | VTILTSLLGTKALGLLIFLQDAAPGASPASATENTFTITEMVKNMGGVAIAVV |
| Ga0307413_105090952 | 3300031824 | Rhizosphere | VTILISLFGTKALGLFMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVI |
| Ga0310893_104342751 | 3300031892 | Soil | VTILTSLLGTKALGLLLFLQDAAASPEASGADHFT |
| Ga0310900_111756752 | 3300031908 | Soil | VTILTSLLGTKALGLLLFLQDAAASPEASGADHFTLTEMVKNMGGVAIA |
| Ga0310884_107959732 | 3300031944 | Soil | VTILTSIFLGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIA |
| Ga0307479_102857191 | 3300031962 | Hardwood Forest Soil | VTILTSLLGTKAIGLLFMLQDAAAAPSPATDANTFTMSEMVKNMGPV |
| Ga0308176_125105091 | 3300031996 | Soil | VTILTSFLGLKALGLLLMFQDAAATPAADAGSQFTLTEMVKNMGGVAIAVVI |
| Ga0307416_1023705222 | 3300032002 | Rhizosphere | VTMLLSIFGTKALGLLMLLQEAAASPEASGAGDHFSLTEMVK |
| Ga0307411_116913131 | 3300032005 | Rhizosphere | VTILTSLFGTKVFGLLLLLQEAAASPEASSADHFTLTEMVKNMGGVAIAV |
| Ga0310896_104956021 | 3300032211 | Soil | VTILTSLLGMKAFGLLMFLQEAAASPESSGADHFTLTEMVKNMGGVA |
| Ga0310810_113691051 | 3300033412 | Soil | VTILTSLFGAKALGLLLLLQEAAASPEASNANQFTLTEMVKNMGGV |
| Ga0314785_025257_374_502 | 3300034479 | Soil | MTILMSVFGTKVLGLLLLLQEAAASPEASSADHFTLTEMVKNM |
| Ga0314780_133323_2_130 | 3300034659 | Soil | MTILMSLMGTKVLGLLLLLQEAAASPEASSADHFTLTEMVKNM |
| ⦗Top⦘ |