Scaffold Ga0082044_11035

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0082044_11035

Scaffold Ga0082044_11035

Overview

Basic Information
Taxon OID	3300006156 Open in IMG/M
Scaffold ID	Ga0082044_11035 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Red Sea brine-pool Kebit Deep Upper-Interfase
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	King Abdullah University of Science and Technology
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	597
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea Brine-Pools

Source Dataset Sampling Location
Location Name	Red Sea
Coordinates	Lat. (^o)	24.7187	Long. (^o)	36.2888	Alt. (m)		Depth (m)	1468
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015265	Metagenome / Metatranscriptome	256	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082044_110352	F015265	N/A	IEKNANVNLNNVGLPVFLNPINDIIPIANPTKNPTKLSIFSNKNSKYG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.