NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006156

3300006156: Marine microbial communities from the Red Sea brine-pool Kebit Deep Upper-Interfase



Overview

Basic Information
IMG/M Taxon OID3300006156 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116808 | Gp0121573 | Ga0082044
Sample NameMarine microbial communities from the Red Sea brine-pool Kebit Deep Upper-Interfase
Sequencing StatusFinished
Sequencing CenterKing Abdullah University of Science and Technology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1674582
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From The Red Sea Brine-Pools
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea Brine-Pools

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Hypersaline (saline)

Location Information
LocationRed Sea
CoordinatesLat. (o)24.7187Long. (o)36.2888Alt. (m)N/ADepth (m)1468
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013310Metagenome272Y
F015265Metagenome / Metatranscriptome256Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0082044_10329Not Available910Open in IMG/M
Ga0082044_11035Not Available597Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0082044_10329Ga0082044_103293F013310MEWLSWSNVAYVIAILIGGYLTISTNKYRKLIKEVQEALEEYHKASKDGNITKSERDAIVKEVLDILSAGIKIFWKL*
Ga0082044_11035Ga0082044_110352F015265IEKNANVNLNNVGLPVFLNPINDIIPIANPTKNPTKLSIFSNKNSKYG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.