Basic Information | |
---|---|
IMG/M Taxon OID | 3300006156 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0116808 | Gp0121573 | Ga0082044 |
Sample Name | Marine microbial communities from the Red Sea brine-pool Kebit Deep Upper-Interfase |
Sequencing Status | Finished |
Sequencing Center | King Abdullah University of Science and Technology |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 1674582 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Microbial Communities From The Red Sea Brine-Pools |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea Brine-Pools |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Red Sea | |||||||
Coordinates | Lat. (o) | 24.7187 | Long. (o) | 36.2888 | Alt. (m) | N/A | Depth (m) | 1468 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013310 | Metagenome | 272 | Y |
F015265 | Metagenome / Metatranscriptome | 256 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0082044_10329 | Not Available | 910 | Open in IMG/M |
Ga0082044_11035 | Not Available | 597 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0082044_10329 | Ga0082044_103293 | F013310 | MEWLSWSNVAYVIAILIGGYLTISTNKYRKLIKEVQEALEEYHKASKDGNITKSERDAIVKEVLDILSAGIKIFWKL* |
Ga0082044_11035 | Ga0082044_110352 | F015265 | IEKNANVNLNNVGLPVFLNPINDIIPIANPTKNPTKLSIFSNKNSKYG* |
⦗Top⦘ |