NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081982_130220

Scaffold Ga0081982_130220


Overview

Basic Information
Taxon OID3300006084 Open in IMG/M
Scaffold IDGa0081982_130220 Open in IMG/M
Source Dataset NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTD1200_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1104
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Water From Within Volcano Caldera → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location NameAxial Seamount, northeast Pacific Ocean
CoordinatesLat. (o)45.9332Long. (o)-129.9988Alt. (m)Depth (m)1200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048174Metagenome / Metatranscriptome148Y
F075867Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0081982_1302201F075867GAGGMNPALKPSTKHFLQYDTATFEHEGFKTLNGRISQLALEPRFWSVSVKVITENYEGTEKIKDHFNFKTSERCKLSDLRDQVKKEVLDKDDYLPVCTQCLVTARVMM*
Ga0081982_1302203F048174GAGMSDKGQSNNKDVQSHSEVVEALLKGEIERLKDDLDRLHRERDAFSRQCSVMAEENQQWEQDSKRLTWMIQNHGRVEFEFNANCYVTFIHKNEFKATLGSDDTRVEIDRAMEMCK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.