| Basic Information | |
|---|---|
| Taxon OID | 3300006079 Open in IMG/M |
| Scaffold ID | Ga0081601_1000997 Open in IMG/M |
| Source Dataset Name | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid D |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Plant Breeding Research |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8915 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (41.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid → Microbial Communities In Diffuse Hydrothermal Fluids Of Manus Basin, Bismarck Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Manus Basin, Bismarck Sea | |||||||
| Coordinates | Lat. (o) | -3.7282978 | Long. (o) | 151.672495 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052659 | Metagenome / Metatranscriptome | 142 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081601_10009973 | F052659 | N/A | MLLSGNPGTEARSAVFIDGRLISSIPELNYQTIDKLQQGGVPDKVSWMKPSLRGRLRLVKLQAQERNLTIEDLNQSIRSKWVILWAEV* |
| ⦗Top⦘ |