NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081425_156296

Scaffold Ga0081425_156296


Overview

Basic Information
Taxon OID3300006065 Open in IMG/M
Scaffold IDGa0081425_156296 Open in IMG/M
Source Dataset NameHotspring Microbial Communities from Lower Geyser Basin, Spring Unknown 43 (Mound Spring), Yellowstone National Park, Wyoming, USA ? Sample 3, Mini-Metagenomics
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterStanford University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7430
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (9.09%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Near-Boiling (>90C) → Alkaline → Hotspring → Mini-Metagenome - Microbial Communities From The Yellowstone National Park

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.564833Long. (o)-110.86325Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038584Metagenome / Metatranscriptome165Y
F044249Metagenome / Metatranscriptome154N
F054062Metagenome / Metatranscriptome140N

Sequences

Protein IDFamilyRBSSequence
Ga0081425_1562962F044249N/AMTKRDAILAFLAGSLTVVAKKYAMVLVALIVLGALANFLGWLHAVVSGEGCKAVKILQGTARLVFYIVFYLALLVALEQVAAYLIPPLLSVAILYEASLALKKAVQLNIIPASLVRQLTNVFRREPPEKAS*
Ga0081425_1562964F038584N/AMTDTIKQIQKAAEELNAVLHATAATEEETKTLDAISKAAAHIRQQLREQMPNAGTRIKVGELRAARKLMQRYLQKTTVGTNIPREYIGESFYVTRQPVIEFIQDYLRTETLDVLAEITQVRLNPFTGAPAVVGEGGEKPTMGTTPQRVNSNYRKIAFTDRITDEALLSYPNIVDFLIWHGAYRIEVFLHNALIMAITAIASGATLPTGIPSPQIADLLIYMRAFHDQQAAIGPRGDWLANIAIVPFPYYWRLIFGGLKTTTGEYIQLDRQLQGLTLIASGTDQSNPTIVLNENELEVFYLGDITVNFGRVFDGASETNVRRLSMDLFYAPLPHPARPVLVADTESAINALA*
Ga0081425_1562967F054062N/AMGNLRQLRWKDFCDGLDKDQPDEIQKEAEHIFFDHVFREVVLTFFQNVSELLLLYEAALSAPAMKPIADAKFNELFKQHPIPFYESFVPVLKNMGAEPEKATFLEICAYLNTYKS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.