| Basic Information | |
|---|---|
| Taxon OID | 3300006061 Open in IMG/M |
| Scaffold ID | Ga0081201_105944 Open in IMG/M |
| Source Dataset Name | Microbial communities from petroleum pipeline sediment, Khambat, Gujarat, India |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Anand Agricultural University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1320 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Industrial Production → Engineered Product → Unclassified → Unclassified → Petroleum Sediment → Microbial Communities From Petroleum Pipeline Sediment, Khambat, Gujarat, India |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Khambat, Gujarat, India | |||||||
| Coordinates | Lat. (o) | 22.172778 | Long. (o) | 72.983333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068106 | Metagenome / Metatranscriptome | 125 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081201_1059442 | F068106 | AGGAG | MPMMTTVIAVALGLAPIPADGTVPFVGADTEKMIGRYSETVDDTGTTHLRGVNRRTGQLYHITVNPYGRVEGSVGDWTVSFNVKTST* |
| ⦗Top⦘ |