NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081201_103104

Scaffold Ga0081201_103104


Overview

Basic Information
Taxon OID3300006061 Open in IMG/M
Scaffold IDGa0081201_103104 Open in IMG/M
Source Dataset NameMicrobial communities from petroleum pipeline sediment, Khambat, Gujarat, India
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAnand Agricultural University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2182
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Industrial Production → Engineered Product → Unclassified → Unclassified → Petroleum Sediment → Microbial Communities From Petroleum Pipeline Sediment, Khambat, Gujarat, India

Source Dataset Sampling Location
Location NameKhambat, Gujarat, India
CoordinatesLat. (o)22.172778Long. (o)72.983333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090845Metagenome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0081201_1031041F090845N/APAASAIVLDTAMGLELIAARGEVASPDDPRLIEKLVLEDEESSVGTLLIGRRSDGNRYNRQEMDAIREIIPSLAEALRVARGRFSRESAMHQRMEEMAARLAQLEGGTPKPA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.