Scaffold Ga0081201_103104

Overview

Basic Information

• Taxon OID: 3300006061
• Scaffold ID: Ga0081201_103104
• Source Dataset Name: Microbial communities from petroleum pipeline sediment, Khambat, Gujarat, India
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Anand Agricultural University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2182
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Industrial Production → Engineered Product → Unclassified → Unclassified → Petroleum Sediment → Microbial Communities From Petroleum Pipeline Sediment, Khambat, Gujarat, India

Source Dataset Sampling Location

• Location Name: Khambat, Gujarat, India
• Coordinates
  • Lat. (^o): 22.172778
  • Long. (^o): 72.983333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090845	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081201_1031041	F090845	N/A	PAASAIVLDTAMGLELIAARGEVASPDDPRLIEKLVLEDEESSVGTLLIGRRSDGNRYNRQEMDAIREIIPSLAEALRVARGRFSRESAMHQRMEEMAARLAQLEGGTPKPA*