NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081540_1049378

Scaffold Ga0081540_1049378


Overview

Basic Information
Taxon OID3300005983 Open in IMG/M
Scaffold IDGa0081540_1049378 Open in IMG/M
Source Dataset NameTabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2099
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location
Location NameUniversity of Puerto Rico, San Juan, Puerto Rico
CoordinatesLat. (o)18.402889Long. (o)-66.050054Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011570Metagenome / Metatranscriptome289Y
F056462Metagenome / Metatranscriptome137Y
F083864Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0081540_10493781F056462GGAGMKTHVALVLAVVFALSPLRGIAEDKQIADVKELAGTWQGWVTREDGQERATLFVSVDGSYRALTTDGASTEGKFYLHDGTLRYRSSRT
Ga0081540_10493782F011570AGGAGGMATKHCAIVLFWWFMVVTQYPGGTLSATTQGPFGNQAQCEWGRQQVGVATGLRGGQGTGWGLTPCWSDGR*
Ga0081540_10493784F083864AGGAGGMNALKSVMLGLALVGVLAGLSACAKRPLVIGGAPAPSPSAAVSPAPAR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.