| Basic Information | |
|---|---|
| Taxon OID | 3300005963 Open in IMG/M |
| Scaffold ID | Ga0081519_105689 Open in IMG/M |
| Source Dataset Name | Hot spring microbial streamer communities from Conch Spring, Yellowstone National Park, USA - C T=80-84 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1329 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Conch Spring, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.5564135 | Long. (o) | -110.8321631 | Alt. (m) | Depth (m) | 2194.56 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013155 | Metagenome / Metatranscriptome | 274 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081519_1056892 | F013155 | GAG | MELYQIIIVAIALANLAVTVWLLRLLYPVWQTLRKVVFAMEHYDFEKLTQQFLNGEKPLAENVVIKTIDKKEEGYREISIIRTYKRPLDPREVQENFVRQMAEKLQ* |
| ⦗Top⦘ |