Scaffold Ga0081519_105689

Overview

Basic Information

• Taxon OID: 3300005963
• Scaffold ID: Ga0081519_105689
• Source Dataset Name: Hot spring microbial streamer communities from Conch Spring, Yellowstone National Park, USA - C T=80-84
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1329
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Conch Spring, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.5564135
  • Long. (^o): -110.8321631
  • Depth (m): 2194.56

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013155	Metagenome / Metatranscriptome	274	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081519_1056892	F013155	GAG	MELYQIIIVAIALANLAVTVWLLRLLYPVWQTLRKVVFAMEHYDFEKLTQQFLNGEKPLAENVVIKTIDKKEEGYREISIIRTYKRPLDPREVQENFVRQMAEKLQ*