Scaffold Ga0058714_100118

Overview

Basic Information

• Taxon OID: 3300005869
• Scaffold ID: Ga0058714_100118
• Source Dataset Name: Rhizosphere microbial communities from Harvard Forest, USA - 3Rhizosphere_NRneg metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 508
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Rhizosphere → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa

Source Dataset Sampling Location

• Location Name: Harvard Forest, Massachusetts, USA
• Coordinates
  • Lat. (^o): 42.5502
  • Long. (^o): -72.1737

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015450	Metagenome / Metatranscriptome	254	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0058714_1001181	F015450	N/A	CIQRLRKIFYSVGASSEKFTPSAEDLPKTFEHIEGEIDELDEVIAGHGDFCAWVASRGTAAAFMKAGCDHGKIVNRPNFTLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGDEARSHLDPVRNHTLCLPFSVNLILTSNNLIRVG*