3300005869: Rhizosphere microbial communities from Harvard Forest, USA - 3Rhizosphere_NRneg metaG

Overview

Basic Information

• IMG/M Taxon OID: 3300005869
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053064 | Gp0104126 | Ga0058714
• Sample Name: Rhizosphere microbial communities from Harvard Forest, USA - 3Rhizosphere_NRneg metaG
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3918344
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Rhizosphere → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): forest biome → rhizosphere → soil
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: Harvard Forest, Massachusetts, USA
• Coordinates
  • Lat. (^o): 42.5502
  • Long. (^o): -72.1737
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015450	Metagenome / Metatranscriptome	254	N
F037171	Metagenome / Metatranscriptome	168	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0058714_100096	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	530
Ga0058714_100118	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	508

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0058714_100096	Ga0058714_1000961	F037171	MDGCMYACNRIENDSVEEPEELVGEAPEQQSVGGGKCPLTYLCPIHSLIHLPHYTFILKD
Ga0058714_100118	Ga0058714_1001181	F015450	CIQRLRKIFYSVGASSEKFTPSAEDLPKTFEHIEGEIDELDEVIAGHGDFCAWVASRGTAAAFMKAGCDHGKIVNRPNFTLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGDEARSHLDPVRNHTLCLPFSVNLILTSNNLIRVG*