Scaffold Ga0058714_100096

Overview

Basic Information

• Taxon OID: 3300005869
• Scaffold ID: Ga0058714_100096
• Source Dataset Name: Rhizosphere microbial communities from Harvard Forest, USA - 3Rhizosphere_NRneg metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 530
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Rhizosphere → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa

Source Dataset Sampling Location

• Location Name: Harvard Forest, Massachusetts, USA
• Coordinates
  • Lat. (^o): 42.5502
  • Long. (^o): -72.1737

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037171	Metagenome / Metatranscriptome	168	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0058714_1000961	F037171	N/A	MDGCMYACNRIENDSVEEPEELVGEAPEQQSVGGGKCPLTYLCPIHSLIHLPHYTFILKD