Scaffold Ga0079997_104853

Overview

Basic Information

• Taxon OID: 3300005853
• Scaffold ID: Ga0079997_104853
• Source Dataset Name: Archaeal communities from Yellowstone National Park, Wyoming, USA - Perpetual Spouter C (PS_C) MetaG (SPADES assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 663
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043237	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079997_1048532	F043237	N/A	LEYDGFVFYLCRLPSKKEVVSYCLPRTEGAFKVYCLSSKPLEFPNAPLKLHYDEKSQRLRLLAQKSFINNCLNAIEKASSLTYPSPKLYTGHVNKLLRQLYGILAYTYNDRERLSAIKRKVKHWVVEALKSQYGLKPKDAMLDYSRYVLKFSDVLRKKKSVFRNL*