| Basic Information | |
|---|---|
| Taxon OID | 3300005852 Open in IMG/M |
| Scaffold ID | Ga0079998_129701 Open in IMG/M |
| Source Dataset Name | Thermal spring microbial communities from Yellowstone National Park, Wyoming, USA - Perpetual Spouter B (PS_B) MetaG (SPADES assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 27665 |
| Total Scaffold Genes | 33 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 30 (90.91%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092976 | Metagenome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079998_12970132 | F092976 | GGAGG | MMVQEILHWKQELRRVRQEFLQIWRECPKCGANWADISWDAESDHEFLLVECKGHHLFRADEEFWLYDCDGMGVYVPSEDCEAEVSAYAG* |
| ⦗Top⦘ |