Scaffold Ga0074477_1707186

Overview

Basic Information

• Taxon OID: 3300005826
• Scaffold ID: Ga0074477_1707186
• Source Dataset Name: Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon Health and Science University (OHSU)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 15440
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Ilwaco, Washington, USA
• Coordinates
  • Lat. (^o): 46.31286
  • Long. (^o): -123.99663

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051162	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074477_17071861	F051162	N/A	MPLVKLFARNTLSKAVPLKALQTELCKIWGTKPETTKLMLFRCEDWTDCDTFTPEDVYVDIRAYGKSERTRDFVLEGMESVQRAFAGHNLVANVRLETYEGDRYFHVPPPAPS*