Basic Information | |
---|---|
Taxon OID | 3300005818 Open in IMG/M |
Scaffold ID | Ga0077106_147330 Open in IMG/M |
Source Dataset Name | Macropus eugenii forestomach microbial communities from Canberra, Australia - Macropus_eugenii_combined |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 764 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Stomach → Unclassified → Macropus Eugenii Forestomach → Macropus Eugenii Forestomach Microbial Communities From Canberra, Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canberra | |||||||
Coordinates | Lat. (o) | -35.310643 | Long. (o) | 149.124184 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013656 | Metagenome | 269 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0077106_1473301 | F013656 | AGGAG | LGDKMSKIYKEPNKSETETTINVVYNENKLSIYTNKIQLQKQLNKLIGEPTKEYKIKRSIAGSSWDISLDNKVLISRVVLKANVFDL* |
⦗Top⦘ |