Basic Information | |
---|---|
IMG/M Taxon OID | 3300005818 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0056632 | Gp0051321 | Ga0077106 |
Sample Name | Macropus eugenii forestomach microbial communities from Canberra, Australia - Macropus_eugenii_combined |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 52808473 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Macropus Eugenii Forestomach Microbial Communities From Canberra, Australia |
Type | Host-Associated |
Taxonomy | Host-Associated → Mammals → Digestive System → Stomach → Unclassified → Macropus Eugenii Forestomach → Macropus Eugenii Forestomach Microbial Communities From Canberra, Australia |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Canberra | |||||||
Coordinates | Lat. (o) | -35.310643 | Long. (o) | 149.124184 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013656 | Metagenome | 269 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0077106_147330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 764 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0077106_147330 | Ga0077106_1473301 | F013656 | LGDKMSKIYKEPNKSETETTINVVYNENKLSIYTNKIQLQKQLNKLIGEPTKEYKIKRSIAGSSWDISLDNKVLISRVVLKANVFDL* |
⦗Top⦘ |