Scaffold Ga0079972_13527

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079972_13527

Scaffold Ga0079972_13527

Overview

Basic Information
Taxon OID	3300005808 Open in IMG/M
Scaffold ID	Ga0079972_13527 Open in IMG/M
Source Dataset Name	Basalt sediment microbial communities from the East Pacific Rise Rocks
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	622
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Benthic → Basalt Sediment → Basalt Sediment Microbial Communities From The East Pacific Rise

Source Dataset Sampling Location
Location Name	East Pacific Rise
Coordinates	Lat. (^o)	9.725	Long. (^o)	-104.16	Alt. (m)		Depth (m)	2674
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093890	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079972_135271	F093890	GGA	VRPRLRFFLFLLSWILSISLFSTVLWANPTFLNRQAYPLPLGLHEIGQFHNNDLKTFEVWTQWSNPSNEKXVVKVTXSFYDKDSADSQLGEDGKDDLLMTVTESVTIPEQTSNWGKYFQLTAIGHKLNQGFDHPGEGAGLELYLDAQVISVKHLP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.