NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079957_1000906

Scaffold Ga0079957_1000906


Overview

Basic Information
Taxon OID3300005805 Open in IMG/M
Scaffold IDGa0079957_1000906 Open in IMG/M
Source Dataset NameMicrobial and algae communities from Cheney Reservoir in Wichita, Kansas, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)27114
Total Scaffold Genes53 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (9.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Microbial And Algae Communities From Cheney Reservoir In Wichita, Kansas, Usa

Source Dataset Sampling Location
Location NameWichita, Kansas, USA
CoordinatesLat. (o)37.7330997Long. (o)-97.7990663Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015602Metagenome / Metatranscriptome253Y
F026551Metagenome / Metatranscriptome197Y

Sequences

Protein IDFamilyRBSSequence
Ga0079957_100090639F015602N/AMTVHLNGKYKKERGLLKPLNISGMKQYEEFVSHIPEGAIVEFFYELQHDDGTLPQLAKLHVMIKQLATHIGETAENMKLLVKDRAGLCIAREVSGKEYFLAKSFAECSREELSLAIQAAIEIGQEVNYLVG*
Ga0079957_100090645F026551N/AMAKSTSAVTKITFGKRKGGKARKGAGPKDKAVSKYRGQGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.