Metagenome / Metatranscriptome Family F026551

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F026551
Family Type	Metagenome / Metatranscriptome
Number of Sequences	197
Average Sequence Length	40 residues
Representative Sequence	MAKVKSTDSRKTTFGKRKGGKAAKSRGPKDKPVSKYRGQGK
Number of Associated Samples	146
Number of Associated Scaffolds	197

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	16.75 %
% of genes near scaffold ends (potentially truncated)	16.75 %
% of genes from short scaffolds (< 2000 bps)	60.41 %
Associated GOLD sequencing projects	135
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (58.883 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (10.660 % of family members)
Environment Ontology (ENVO)	Unclassified (48.223 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (54.822 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.35% β-sheet: 0.00% Coil/Unstructured: 95.65%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.19
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 197 Family Scaffolds
PF00182	Glyco_hydro_19	9.64
PF00436	SSB	7.11
PF00166	Cpn10	3.55
PF03796	DnaB_C	2.54
PF13539	Peptidase_M15_4	2.54
PF00534	Glycos_transf_1	2.03
PF08291	Peptidase_M15_3	2.03
PF08299	Bac_DnaA_C	1.52
PF07460	NUMOD3	1.02
PF01510	Amidase_2	1.02
PF12838	Fer4_7	1.02
PF02777	Sod_Fe_C	1.02
PF03167	UDG	1.02
PF07728	AAA_5	1.02
PF13482	RNase_H_2	1.02
PF01520	Amidase_3	1.02
PF04851	ResIII	1.02
PF00081	Sod_Fe_N	1.02
PF01541	GIY-YIG	1.02
PF09374	PG_binding_3	0.51
PF03692	CxxCxxCC	0.51
PF01075	Glyco_transf_9	0.51
PF01183	Glyco_hydro_25	0.51
PF05766	NinG	0.51
PF01653	DNA_ligase_aden	0.51
PF00692	dUTPase	0.51
PF12957	DUF3846	0.51
PF05257	CHAP	0.51
PF13479	AAA_24	0.51
PF14902	DUF4494	0.51
PF00271	Helicase_C	0.51
PF03237	Terminase_6N	0.51
PF04480	DUF559	0.51
PF00959	Phage_lysozyme	0.51
PF14550	Peptidase_S78_2	0.51
PF13589	HATPase_c_3	0.51
PF04860	Phage_portal	0.51
PF00583	Acetyltransf_1	0.51
PF13426	PAS_9	0.51
PF00149	Metallophos	0.51
PF04984	Phage_sheath_1	0.51
PF07603	DUF1566	0.51

COG ID	Name	Functional Category	% Frequency in 197 Family Scaffolds
COG3979	Chitodextrinase	Carbohydrate transport and metabolism [G]	9.64
COG3179	Chitinase, GH19 family	Carbohydrate transport and metabolism [G]	9.64
COG0629	Single-stranded DNA-binding protein	Replication, recombination and repair [L]	7.11
COG2965	Primosomal replication protein N	Replication, recombination and repair [L]	7.11
COG0234	Co-chaperonin GroES (HSP10)	Posttranslational modification, protein turnover, chaperones [O]	3.55
COG0305	Replicative DNA helicase	Replication, recombination and repair [L]	2.54
COG1066	DNA repair protein RadA/Sms, contains AAA+ ATPase domain	Replication, recombination and repair [L]	2.54
COG0605	Superoxide dismutase	Inorganic ion transport and metabolism [P]	2.03
COG0593	Chromosomal replication initiation ATPase DnaA	Replication, recombination and repair [L]	1.52
COG0692	Uracil-DNA glycosylase	Replication, recombination and repair [L]	1.02
COG3663	G:T/U-mismatch repair DNA glycosylase	Replication, recombination and repair [L]	1.02
COG0860	N-acetylmuramoyl-L-alanine amidase	Cell wall/membrane/envelope biogenesis [M]	1.02
COG1573	Uracil-DNA glycosylase	Replication, recombination and repair [L]	1.02
COG0859	ADP-heptose:LPS heptosyltransferase	Cell wall/membrane/envelope biogenesis [M]	0.51
COG3757	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family	Cell wall/membrane/envelope biogenesis [M]	0.51
COG3497	Phage tail sheath protein FI	Mobilome: prophages, transposons [X]	0.51
COG0756	dUTP pyrophosphatase (dUTPase)	Defense mechanisms [V]	0.51
COG0717	dCTP deaminase	Nucleotide transport and metabolism [F]	0.51
COG0272	NAD-dependent DNA ligase	Replication, recombination and repair [L]	0.51

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.88 %
All Organisms	root	All Organisms	41.12 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.88 %
cellular organisms	root	All Organisms → cellular organisms	26.90 %
Viruses	superkingdom	All Organisms → Viruses	14.21 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.88 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	26.90 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	10.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.03 %
unclassified viruses	clade	All Organisms → Viruses → unclassified viruses	1.02 %
Varidnaviria	clade	All Organisms → Viruses → Varidnaviria	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.88 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	10.15 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	10.66 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.03 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.02 %
Virus NIOZ-UU157	species	All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	1.02 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	1.02 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.51 %
Bamfordvirae	kingdom	All Organisms → Viruses → Varidnaviria → Bamfordvirae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.88 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	10.15 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	10.66 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.03 %
unclassified Spirochaetota	no rank	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota	1.02 %
Virus NIOZ-UU157	species	All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	1.02 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.51 %
Nucleocytoviricota	phylum	All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota	0.51 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.51 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.88 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	10.15 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	10.66 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.03 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1.02 %
Virus NIOZ-UU157	species	All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	1.02 %
unclassified Firmicutes sensu stricto	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto	0.51 %
Dehalococcoidia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia	0.51 %
Patescibacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group	0.51 %
Nucleocytoviricota	phylum	All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.88 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	8.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.03 %
Sphingobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia	1.52 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1.02 %
Virus NIOZ-UU157	species	All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	1.02 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.51 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.51 %
unclassified Caudoviricetes	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes	0.51 %
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	0.51 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.51 %
unclassified Dehalococcoidia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia	0.51 %
Saprospiria	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria	0.51 %
Parcubacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group	0.51 %
Firmicutes bacterium ADurb.Bin419	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin419	0.51 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	0.51 %
Nucleocytoviricota	phylum	All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.88 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.03 %
unclassified Sphingobacteriia	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia	1.52 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1.02 %
Virus NIOZ-UU157	species	All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	1.02 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	0.51 %
Marinilabiliales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales	0.51 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	0.51 %
Siphoviridae sp. ctEw721	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctEw721	0.51 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.51 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.51 %
unclassified Parcubacteria group	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group	0.51 %
Saprospirales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales	0.51 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.51 %
Firmicutes bacterium ADurb.Bin419	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin419	0.51 %
Nucleocytoviricota	phylum	All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.88 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.03 %
Sphingobacteriia bacterium 28-36-52	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-52	1.52 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1.02 %
Virus NIOZ-UU157	species	All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	1.02 %
unclassified Saprospirales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales	0.51 %
Prolixibacteraceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae	0.51 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.51 %
Parcubacteria group bacterium ADurb.Bin216	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216	0.51 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	0.51 %
Siphoviridae sp. ctEw721	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctEw721	0.51 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.51 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.51 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.51 %
Firmicutes bacterium ADurb.Bin419	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin419	0.51 %
Nucleocytoviricota	phylum	All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.88 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.03 %
Sphingobacteriia bacterium 28-36-52	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-52	1.52 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1.02 %
Virus NIOZ-UU157	species	All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	1.02 %
Saprospirales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium	0.51 %
unclassified Prolixibacteraceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae	0.51 %
Taibaiella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Taibaiella	0.51 %
Parcubacteria group bacterium ADurb.Bin216	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216	0.51 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	0.51 %
Siphoviridae sp. ctEw721	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctEw721	0.51 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.51 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.51 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.51 %
Firmicutes bacterium ADurb.Bin419	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin419	0.51 %
Nucleocytoviricota	phylum	All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.88 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.03 %
Sphingobacteriia bacterium 28-36-52	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-52	1.52 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1.02 %
Virus NIOZ-UU157	species	All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	1.02 %
Prolixibacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium	0.51 %
Taibaiella soli	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Taibaiella → Taibaiella soli	0.51 %
Saprospirales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium	0.51 %
Parcubacteria group bacterium ADurb.Bin216	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216	0.51 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	0.51 %
Siphoviridae sp. ctEw721	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctEw721	0.51 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.51 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.51 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.51 %
Firmicutes bacterium ADurb.Bin419	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin419	0.51 %
Nucleocytoviricota	phylum	All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota	0.51 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000439\|TBL_comb48_EPIDRAFT_1000012	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	132374	Open in IMG/M
3300000882\|FwDRAFT_10014802	All Organisms → cellular organisms → Bacteria	8517	Open in IMG/M
3300000882\|FwDRAFT_10217095	All Organisms → cellular organisms → Bacteria	1218	Open in IMG/M
3300001275\|B570J13894_1020711	Not Available	621	Open in IMG/M
3300001838\|RCM33_1093706	Not Available	502	Open in IMG/M
3300001839\|RCM40_1045144	Not Available	806	Open in IMG/M
3300001847\|RCM41_1136803	Not Available	748	Open in IMG/M
3300001848\|RCM47_1051387	All Organisms → cellular organisms → Bacteria	800	Open in IMG/M
3300001851\|RCM31_10103288	All Organisms → cellular organisms → Bacteria	1025	Open in IMG/M
3300001968\|GOS2236_1030644	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctEw721	848	Open in IMG/M
3300002092\|JGI24218J26658_1014976	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1159	Open in IMG/M
3300002098\|JGI24219J26650_1005372	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2613	Open in IMG/M
3300002161\|JGI24766J26685_10030466	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1289	Open in IMG/M
3300002408\|B570J29032_109930943	Not Available	3067	Open in IMG/M
3300002835\|B570J40625_100892083	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	771	Open in IMG/M
3300002835\|B570J40625_100969729	Not Available	729	Open in IMG/M
3300003808\|Ga0007844_1000006	All Organisms → cellular organisms → Bacteria	23952	Open in IMG/M
3300003815\|Ga0007856_1000105	Not Available	9291	Open in IMG/M
3300003852\|Ga0031655_10005776	Not Available	6689	Open in IMG/M
3300003859\|Ga0031653_10117742	All Organisms → cellular organisms → Bacteria	694	Open in IMG/M
3300004461\|Ga0066223_1295133	All Organisms → cellular organisms → Bacteria	976	Open in IMG/M
3300004481\|Ga0069718_15655823	Not Available	698	Open in IMG/M
3300004771\|Ga0007797_1157841	Not Available	577	Open in IMG/M
3300004774\|Ga0007794_10104886	Not Available	843	Open in IMG/M
3300005527\|Ga0068876_10000338	All Organisms → cellular organisms → Bacteria	37499	Open in IMG/M
3300005581\|Ga0049081_10000756	All Organisms → cellular organisms → Bacteria	12301	Open in IMG/M
3300005581\|Ga0049081_10006829	All Organisms → cellular organisms → Bacteria	4316	Open in IMG/M
3300005581\|Ga0049081_10119714	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	974	Open in IMG/M
3300005585\|Ga0049084_10219316	Not Available	645	Open in IMG/M
3300005662\|Ga0078894_10457802	Not Available	1149	Open in IMG/M
3300005805\|Ga0079957_1000906	All Organisms → cellular organisms → Bacteria	27114	Open in IMG/M
3300005805\|Ga0079957_1001911	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-52	18728	Open in IMG/M
3300005805\|Ga0079957_1017027	Not Available	5202	Open in IMG/M
3300005805\|Ga0079957_1027846	Not Available	3793	Open in IMG/M
3300005805\|Ga0079957_1287134	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	746	Open in IMG/M
3300006103\|Ga0007813_1042190	Not Available	968	Open in IMG/M
3300006484\|Ga0070744_10209744	Not Available	553	Open in IMG/M
3300006639\|Ga0079301_1154628	Not Available	676	Open in IMG/M
3300006802\|Ga0070749_10006110	All Organisms → cellular organisms → Bacteria	7908	Open in IMG/M
3300006805\|Ga0075464_10733212	Not Available	612	Open in IMG/M
3300006875\|Ga0075473_10071993	Not Available	1352	Open in IMG/M
3300006875\|Ga0075473_10290064	Not Available	662	Open in IMG/M
3300007165\|Ga0079302_1081012	Not Available	697	Open in IMG/M
3300007538\|Ga0099851_1226111	Not Available	675	Open in IMG/M
3300007548\|Ga0102877_1041116	Not Available	1344	Open in IMG/M
3300007553\|Ga0102819_1043954	Not Available	755	Open in IMG/M
3300007559\|Ga0102828_1058073	Not Available	907	Open in IMG/M
3300007559\|Ga0102828_1158897	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300007562\|Ga0102915_1005808	All Organisms → Viruses → Predicted Viral	4120	Open in IMG/M
3300007624\|Ga0102878_1223561	Not Available	536	Open in IMG/M
3300007625\|Ga0102870_1130352	Not Available	727	Open in IMG/M
3300007735\|Ga0104988_10792	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	29589	Open in IMG/M
3300007973\|Ga0105746_1010501	All Organisms → Viruses → Predicted Viral	2628	Open in IMG/M
3300007974\|Ga0105747_1064517	Not Available	1100	Open in IMG/M
3300007974\|Ga0105747_1074767	Not Available	1031	Open in IMG/M
3300007992\|Ga0105748_10058677	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin419	1498	Open in IMG/M
3300007992\|Ga0105748_10148108	Not Available	961	Open in IMG/M
3300008107\|Ga0114340_1095078	Not Available	1202	Open in IMG/M
3300008108\|Ga0114341_10366323	Not Available	716	Open in IMG/M
3300008110\|Ga0114343_1007626	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216	5510	Open in IMG/M
3300008113\|Ga0114346_1204893	All Organisms → cellular organisms → Bacteria	783	Open in IMG/M
3300008116\|Ga0114350_1003002	Not Available	10800	Open in IMG/M
3300008267\|Ga0114364_1000177	Not Available	41376	Open in IMG/M
3300008267\|Ga0114364_1009613	All Organisms → cellular organisms → Bacteria	5201	Open in IMG/M
3300008267\|Ga0114364_1026483	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	2324	Open in IMG/M
3300008450\|Ga0114880_1029901	Not Available	2442	Open in IMG/M
3300008450\|Ga0114880_1041178	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2004	Open in IMG/M
3300008450\|Ga0114880_1164130	Not Available	784	Open in IMG/M
3300008999\|Ga0102816_1021982	Not Available	1842	Open in IMG/M
3300009037\|Ga0105093_10023173	Not Available	2641	Open in IMG/M
3300009050\|Ga0102909_1091285	Not Available	741	Open in IMG/M
3300009068\|Ga0114973_10001587	Not Available	16815	Open in IMG/M
3300009075\|Ga0105090_10455327	Not Available	779	Open in IMG/M
3300009081\|Ga0105098_10432314	Not Available	659	Open in IMG/M
3300009085\|Ga0105103_10078100	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1699	Open in IMG/M
3300009085\|Ga0105103_10194171	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1084	Open in IMG/M
3300009085\|Ga0105103_10383382	Not Available	776	Open in IMG/M
3300009151\|Ga0114962_10000019	Not Available	124635	Open in IMG/M
3300009151\|Ga0114962_10000549	Not Available	33459	Open in IMG/M
3300009151\|Ga0114962_10133190	All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	1510	Open in IMG/M
3300009151\|Ga0114962_10656558	Not Available	539	Open in IMG/M
3300009157\|Ga0105092_10150796	All Organisms → Viruses → Predicted Viral	1291	Open in IMG/M
3300009159\|Ga0114978_10031946	All Organisms → cellular organisms → Bacteria	3753	Open in IMG/M
3300009163\|Ga0114970_10000123	All Organisms → cellular organisms → Bacteria	50206	Open in IMG/M
3300009165\|Ga0105102_10011613	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	3385	Open in IMG/M
3300009165\|Ga0105102_10403375	Not Available	727	Open in IMG/M
3300009169\|Ga0105097_10606715	Not Available	616	Open in IMG/M
3300009183\|Ga0114974_10008175	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	7666	Open in IMG/M
3300010157\|Ga0114964_10001329	All Organisms → cellular organisms → Bacteria	18043	Open in IMG/M
3300010157\|Ga0114964_10022166	Not Available	3611	Open in IMG/M
3300010158\|Ga0114960_10523304	Not Available	567	Open in IMG/M
3300010354\|Ga0129333_10013532	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-52	7744	Open in IMG/M
3300010354\|Ga0129333_10038318	Not Available	4524	Open in IMG/M
3300010354\|Ga0129333_10223697	Not Available	1706	Open in IMG/M
3300010354\|Ga0129333_10284393	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-52	1483	Open in IMG/M
3300010354\|Ga0129333_10321895	Not Available	1380	Open in IMG/M
3300010354\|Ga0129333_10799334	Not Available	804	Open in IMG/M
3300010354\|Ga0129333_10845083	Not Available	778	Open in IMG/M
3300010885\|Ga0133913_10326761	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4061	Open in IMG/M
3300010885\|Ga0133913_10514971	Not Available	3151	Open in IMG/M
3300010885\|Ga0133913_11493905	Not Available	1712	Open in IMG/M
3300012017\|Ga0153801_1051852	Not Available	722	Open in IMG/M
3300012017\|Ga0153801_1054307	Not Available	704	Open in IMG/M
3300013004\|Ga0164293_10130497	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1891	Open in IMG/M
(restricted) 3300013129\|Ga0172364_10380311	Not Available	909	Open in IMG/M
3300013372\|Ga0177922_10811168	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	508	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10286363	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	992	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10602489	Not Available	602	Open in IMG/M
3300017754\|Ga0181344_1010451	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2982	Open in IMG/M
3300017766\|Ga0181343_1107481	All Organisms → cellular organisms → Bacteria	790	Open in IMG/M
3300018775\|Ga0188848_1005482	Not Available	1428	Open in IMG/M
3300019784\|Ga0181359_1118119	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	952	Open in IMG/M
3300019784\|Ga0181359_1120968	Not Available	936	Open in IMG/M
3300020084\|Ga0194110_10750039	Not Available	598	Open in IMG/M
3300020141\|Ga0211732_1414108	Not Available	4308	Open in IMG/M
3300020151\|Ga0211736_10187574	Not Available	1389	Open in IMG/M
3300020151\|Ga0211736_10498217	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5850	Open in IMG/M
3300020151\|Ga0211736_10839808	Not Available	12575	Open in IMG/M
3300020159\|Ga0211734_11317042	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	775	Open in IMG/M
3300020161\|Ga0211726_10345265	Not Available	641	Open in IMG/M
3300020161\|Ga0211726_10865263	Not Available	802	Open in IMG/M
3300020164\|Ga0194037_1175341	Not Available	699	Open in IMG/M
3300020205\|Ga0211731_11525948	Not Available	826	Open in IMG/M
3300020222\|Ga0194125_10711464	All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	584	Open in IMG/M
3300020229\|Ga0194042_1143763	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Taibaiella → Taibaiella soli	643	Open in IMG/M
3300020512\|Ga0207936_1002083	All Organisms → Viruses	3965	Open in IMG/M
3300020518\|Ga0208721_1027386	Not Available	709	Open in IMG/M
3300020563\|Ga0208082_1030389	Not Available	1034	Open in IMG/M
3300020731\|Ga0214170_1000216	All Organisms → cellular organisms → Bacteria	24266	Open in IMG/M
3300021079\|Ga0194055_10003411	Not Available	12203	Open in IMG/M
3300021131\|Ga0214206_1008837	Not Available	1501	Open in IMG/M
3300021142\|Ga0214192_1009921	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	3906	Open in IMG/M
3300021354\|Ga0194047_10000162	Not Available	46996	Open in IMG/M
3300021961\|Ga0222714_10023858	All Organisms → cellular organisms → Bacteria	4704	Open in IMG/M
3300022179\|Ga0181353_1018521	Not Available	1818	Open in IMG/M
3300022179\|Ga0181353_1041333	Not Available	1218	Open in IMG/M
3300022407\|Ga0181351_1164864	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	781	Open in IMG/M
3300022407\|Ga0181351_1275328	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300022752\|Ga0214917_10198274	Not Available	993	Open in IMG/M
3300023184\|Ga0214919_10052369	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3887	Open in IMG/M
3300024346\|Ga0244775_10119519	Not Available	2234	Open in IMG/M
3300024346\|Ga0244775_11203100	Not Available	590	Open in IMG/M
3300024346\|Ga0244775_11278032	Not Available	569	Open in IMG/M
3300025896\|Ga0208916_10306118	Not Available	692	Open in IMG/M
3300027186\|Ga0208797_1037120	Not Available	628	Open in IMG/M
3300027244\|Ga0208173_1072655	Not Available	593	Open in IMG/M
3300027659\|Ga0208975_1003026	All Organisms → cellular organisms → Bacteria	6500	Open in IMG/M
3300027659\|Ga0208975_1033282	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1637	Open in IMG/M
3300027693\|Ga0209704_1221744	Not Available	552	Open in IMG/M
3300027708\|Ga0209188_1000167	Not Available	73524	Open in IMG/M
3300027710\|Ga0209599_10060895	Not Available	992	Open in IMG/M
3300027736\|Ga0209190_1000102	All Organisms → cellular organisms → Bacteria	55992	Open in IMG/M
3300027743\|Ga0209593_10004820	Not Available	5626	Open in IMG/M
3300027747\|Ga0209189_1000038	Not Available	124552	Open in IMG/M
3300027759\|Ga0209296_1046321	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2295	Open in IMG/M
3300027763\|Ga0209088_10084729	Not Available	1477	Open in IMG/M
3300027782\|Ga0209500_10009846	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	5937	Open in IMG/M
3300027793\|Ga0209972_10044375	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	2464	Open in IMG/M
3300027805\|Ga0209229_10072055	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1549	Open in IMG/M
3300027805\|Ga0209229_10221330	Not Available	845	Open in IMG/M
3300027816\|Ga0209990_10000038	All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota	126638	Open in IMG/M
3300027900\|Ga0209253_10154241	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium	1858	Open in IMG/M
3300027900\|Ga0209253_10233934	Not Available	1453	Open in IMG/M
3300027972\|Ga0209079_10052962	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1371	Open in IMG/M
3300028025\|Ga0247723_1003471	All Organisms → cellular organisms → Bacteria	7847	Open in IMG/M
3300028392\|Ga0304729_1111989	Not Available	917	Open in IMG/M
3300031746\|Ga0315293_10031905	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	4646	Open in IMG/M
3300031758\|Ga0315907_10593658	Not Available	860	Open in IMG/M
3300031784\|Ga0315899_10612835	Not Available	1025	Open in IMG/M
3300031787\|Ga0315900_10580302	Not Available	826	Open in IMG/M
3300031857\|Ga0315909_10478606	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	867	Open in IMG/M
3300031952\|Ga0315294_10407742	Not Available	1270	Open in IMG/M
3300031952\|Ga0315294_10824777	Not Available	796	Open in IMG/M
3300032053\|Ga0315284_10086827	All Organisms → Viruses → Predicted Viral	4215	Open in IMG/M
3300032053\|Ga0315284_10858832	Not Available	1042	Open in IMG/M
3300032053\|Ga0315284_10971218	Not Available	961	Open in IMG/M
3300032516\|Ga0315273_10216455	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2616	Open in IMG/M
3300033978\|Ga0334977_0011232	Not Available	5109	Open in IMG/M
3300033980\|Ga0334981_0002956	All Organisms → cellular organisms → Bacteria	10794	Open in IMG/M
3300033981\|Ga0334982_0000351	All Organisms → cellular organisms → Bacteria	28321	Open in IMG/M
3300034012\|Ga0334986_0317313	Not Available	820	Open in IMG/M
3300034018\|Ga0334985_0037675	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium	3655	Open in IMG/M
3300034061\|Ga0334987_0108940	Not Available	2112	Open in IMG/M
3300034061\|Ga0334987_0369556	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	921	Open in IMG/M
3300034104\|Ga0335031_0158180	Not Available	1562	Open in IMG/M
3300034116\|Ga0335068_0070149	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2011	Open in IMG/M
3300034118\|Ga0335053_0017026	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	5261	Open in IMG/M
3300034118\|Ga0335053_0369904	Not Available	878	Open in IMG/M
3300034272\|Ga0335049_0571531	Not Available	706	Open in IMG/M
3300034279\|Ga0335052_0048348	Not Available	2632	Open in IMG/M
3300034355\|Ga0335039_0473377	Not Available	632	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	97.97%
Terrestrial	Environmental → Terrestrial	2.03%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	79.70%
Marine	Environmental → Aquatic → Marine	18.27%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	2.03%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	42.64%
Lentic	Environmental → Aquatic → Freshwater → Lentic	23.35%
Coastal	Environmental → Aquatic → Marine → Coastal	9.64%
Sediment	Environmental → Aquatic → Freshwater → Sediment	7.11%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	6.09%
Lotic	Environmental → Aquatic → Freshwater → Lotic	3.55%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	2.54%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.54%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	2.03%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	38.58%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	16.75%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	9.64%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	7.11%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	5.58%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	4.57%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.06%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	3.55%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	2.54%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.54%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	2.03%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	2.03%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.51%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	10.66%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	10.66%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	7.61%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	6.60%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	6.09%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	5.58%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	4.57%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	4.06%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	4.06%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	3.55%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	3.55%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	3.05%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	3.05%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.54%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	2.54%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	2.54%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	2.54%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	2.54%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	2.03%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	2.03%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	2.03%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	1.52%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.52%
Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic	1.02%
Freshwater And Marine	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine	1.02%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	0.51%
Surface Water	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water	0.51%
Marine	Environmental → Aquatic → Marine → Coastal → Unclassified → Marine	0.51%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.51%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	0.51%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.51%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000439	Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem)	Environmental	Open in IMG/M
3300000882	Freshwater microbial communities from the Columbia River	Environmental	Open in IMG/M
3300001275	Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion	Environmental	Open in IMG/M
3300001838	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a	Environmental	Open in IMG/M
3300001839	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b	Environmental	Open in IMG/M
3300001847	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a	Environmental	Open in IMG/M
3300001848	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a	Environmental	Open in IMG/M
3300001851	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b	Environmental	Open in IMG/M
3300001968	Marine microbial communities from Lake Gatun, Panama - GS020	Environmental	Open in IMG/M
3300002092	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome	Environmental	Open in IMG/M
3300002098	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome	Environmental	Open in IMG/M
3300002161	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003808	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Aug07	Environmental	Open in IMG/M
3300003815	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07	Environmental	Open in IMG/M
3300003852	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB	Environmental	Open in IMG/M
3300003859	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR	Environmental	Open in IMG/M
3300004461	Marine viral communities from Newfoundland, Canada BC-2	Environmental	Open in IMG/M
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental	Open in IMG/M
3300004771	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M	Environmental	Open in IMG/M
3300004774	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006103	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006875	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA	Environmental	Open in IMG/M
3300007165	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16	Environmental	Open in IMG/M
3300007538	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG	Environmental	Open in IMG/M
3300007548	Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3	Environmental	Open in IMG/M
3300007553	Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007562	Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02	Environmental	Open in IMG/M
3300007624	Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02	Environmental	Open in IMG/M
3300007625	Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02	Environmental	Open in IMG/M
3300007735	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct	Environmental	Open in IMG/M
3300007973	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300007992	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300008999	Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545	Environmental	Open in IMG/M
3300009037	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009050	Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009075	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010158	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013129 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014720 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m	Environmental	Open in IMG/M
3300014962	Surface water microbial communities from Bangladesh - BaraHaldiaSW0309	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300018775	Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020084	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020164	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020222	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m	Environmental	Open in IMG/M
3300020229	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-12m	Environmental	Open in IMG/M
3300020512	Freshwater microbial communities from Lake Mendota, WI - 19NOV2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020518	Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020563	Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300020731	Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion	Environmental	Open in IMG/M
3300021079	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m	Environmental	Open in IMG/M
3300021131	Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion	Environmental	Open in IMG/M
3300021142	Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion	Environmental	Open in IMG/M
3300021354	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027186	Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)	Environmental	Open in IMG/M
3300027244	Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027693	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027743	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027747	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027764	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027816	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300027972	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028392	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033980	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034013	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034	Environmental	Open in IMG/M
3300034018	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental	Open in IMG/M
3300034118	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165	Environmental	Open in IMG/M
3300034272	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156	Environmental	Open in IMG/M
3300034279	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163	Environmental	Open in IMG/M
3300034355	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
TBL_comb48_EPIDRAFT_1000012109	3300000439	Freshwater	MAKGSVTNANKVTFGSRKGGKAKKSSGPKDKKVSKYIGQGK*
FwDRAFT_1001480216	3300000882	Freshwater And Marine	MAKVTGNSTKLSFGKRKGGKAQKTQGPKQKSVSKYRGQGK*
FwDRAFT_102170952	3300000882	Freshwater And Marine	MSKGKSLGATKVTFGKRKGGKAVKSRSPKDKKVSKYKGQGR*
B570J13894_10207111	3300001275	Freshwater	MAKSKSSGDSRKVNFGKRKGGKARKTSGPKDKKVSKYVGQGK*
RCM33_10937062	3300001838	Marine Plankton	MAKKQGKTGTAAGIKISFGVRKGGKHKKFRGPKEKMVSKYRGQGR*
RCM40_10451442	3300001839	Marine Plankton	MAKSKAADSKKISFGKRKGGKAAKTKGPKDKAVSKYRGQGKLSL
RCM41_11368032	3300001847	Marine Plankton	SVGNSTKLSFGKRKSGKARKSRSPKDKNVSKYRGQGK*
RCM47_10513872	3300001848	Marine Plankton	MAKSVGNSTKLSFGKRKSGKARKSRSPKDKNVSKYRGQGK*
RCM31_101032881	3300001851	Marine Plankton	MAKATRGEARKVTFGKRKKGKAAKFKGPKDKPVSKYRGQGR*
GOS2236_10306442	3300001968	Marine	MAKPKGSADKKKITFGTRKGGKPRKSRGPKDKGVSKYQGQGR*
JGI24218J26658_10149761	3300002092	Lentic	KSANSNKITFGKRKGGKARKTSGPKDKNKKPNVGQGH*
JGI24219J26650_10053721	3300002098	Lentic	MAKAKAISSTKLTFGKRKGGRAQKRSGPKDKPVSKYIGQGK*
JGI24766J26685_100304663	3300002161	Freshwater And Sediment	MAGKVKAGDAKKVTFGVRKGGKAQKLRGPKQKKVSKYRGQGR*
B570J29032_1099309433	3300002408	Freshwater	MAKSVNSNKLTFGKRKGGKAKKTSGPKDAPTKIYRGQGKKH*
B570J40625_1008920832	3300002835	Freshwater	KVKAGDAKKVTFGVRKGGKAQKLRGPKQKKVSKYRGQGR*
B570J40625_1009697291	3300002835	Freshwater	MAKITNANKVSFGKRKGGKASKSRGPKDKRVSKYIGQGK*
Ga0007844_100000612	3300003808	Freshwater	MAKAVGNTRKLTFGKRKGGKAKKSSGPKDKKVSKYRSQGR*
Ga0007856_10001059	3300003815	Freshwater	MAGKKSSADNRKVTFGKRXRGKASKTKGPKDKPVKQYQGQGR*
Ga0031655_100057767	3300003852	Freshwater Lake Sediment	MAKSKSTDSRKISFGKRKGGKAAKTSGPKDKPVKKYRGQGK*
Ga0031653_101177422	3300003859	Freshwater Lake Sediment	MAKATTTSNKINFGKRKGGKYKKSSGPKDKNVSRYRGQGK*
Ga0066223_12951332	3300004461	Marine	MAKVLGNSTKLSFGKRKGGKAKNSKSPKEKNVSQYKGQGK*
Ga0069718_156558232	3300004481	Sediment	MAKGKGSSDRQKISFGKRKGGKAAKTSGPKDKNKKAYRGQGK*
Ga0007797_11578412	3300004771	Freshwater	MAKAASSVKKISFGKRKGGKASKTKGPKAKAVSKYRGQGK*
Ga0007794_101048861	3300004774	Freshwater	MAKLKGVSSNKVTFGKRKGGKAAKRSGPKDKPVSKYIGQGK*
Ga0068876_1000033867	3300005527	Freshwater Lake	MAKGKLTDSRKITFGKRKGGKAAKSRGPKDKSVSKYRAQGR*
Ga0049081_1000075615	3300005581	Freshwater Lentic	MAKVTKSASSTKISFGKRKGGKATKSSGPKDKSVSAYRSQGR*
Ga0049081_100068298	3300005581	Freshwater Lentic	MAKGTFSANKIVFGKRKGGKPAKSKGPKDKSVSKYRGQGKA*
Ga0049081_101197141	3300005581	Freshwater Lentic	MAKATGNSTKLSFGKRKGGKAQKTRGPKQKSVSQYRGQGK*
Ga0049084_102193162	3300005585	Freshwater Lentic	MAKAKVGDSRKITFGKRRAGRLRKRSGPKAKKVSKYRGQGR*
Ga0078894_104578022	3300005662	Freshwater Lake	MAKPKAGESRKISFGKRKGGRLRKRSGPKDKKVSKYRGQGK*
Ga0079957_100090645	3300005805	Lake	MAKSTSAVTKITFGKRKGGKARKGAGPKDKAVSKYRGQGR*
Ga0079957_100191115	3300005805	Lake	MAKINGAANKITFGTRKGRKARKSRGPKDKGISKYRGQGR*
Ga0079957_10170271	3300005805	Lake	MAKATGTSAKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0079957_10278465	3300005805	Lake	MAKVKSADSRKTTFGKRKGGKASKLRGPKDKPVSKYRGQGR*
Ga0079957_12871342	3300005805	Lake	MAKNNSSNKVVFGTRKGGKAKKSRGPKDKKISKYQGQGR*
Ga0007813_10421902	3300006103	Freshwater	MAKSTGSASSIKTVFGKRKCGKAKKSSGPKDKKVSKYVGQGK*
Ga0070744_102097442	3300006484	Estuarine	MAKVKSDSRKVSFGKRKGGKATKTSGPKAKKISKYR
Ga0079301_11546283	3300006639	Deep Subsurface	VTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0070749_1000611014	3300006802	Aqueous	MAKATGNSTKLSFGKRKGGKAQKTRGPKQKAVSQYRGQGK*
Ga0075464_107332122	3300006805	Aqueous	MAKTISSIKATFGKRKGGKAQKRKGPKDKAVSKYKGQGKL*
Ga0075473_100719933	3300006875	Aqueous	MAKSISGANKVTFGKRKGGKPSKSKGPKVKSTSLYRGQGR*
Ga0075473_102900642	3300006875	Aqueous	MAKAKGGEVRKISFGKRKGGKAKKTTGPKDKAVSKYRGQ
Ga0079302_10810121	3300007165	Deep Subsurface	INFMAKVTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0099851_12261113	3300007538	Aqueous	MAKATGTSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0102877_10411161	3300007548	Estuarine	MAKVKSDSRKVSFGKRKGGKATKTSGPKAKAVSKYRGQGR*
Ga0102819_10439542	3300007553	Estuarine	MAKVKSDSRKISFGKRKGGKATKTSGPKAKKISQYRGQGR*
Ga0102828_10580731	3300007559	Estuarine	MAKSKAIGDVKKVTFGARKTGKAKKGSGPKDKSVSKYRGQGR*
Ga0102828_11588972	3300007559	Estuarine	AKSKAVSSIKATFGKRKGGKAQKRSGPKDKPVSKYIGQGK*
Ga0102915_10058083	3300007562	Estuarine	MAKVKSDSRKISFGKRKGGKASKTSGPKAKAVSKYRGQGR*
Ga0102878_12235611	3300007624	Estuarine	MAKVKSDSRKISFGKRKTGRAYKTSGPKAKKISKY
Ga0102870_11303521	3300007625	Estuarine	MAKAKGGSTSMKITFGKRRNGKYAKSTGPKAKKVSK
Ga0104988_1079212	3300007735	Freshwater	MAKTISSNKLSFGKRKGGKARKSKGPKDKNVSKYKGQGK*
Ga0105746_10105011	3300007973	Estuary Water	AKSSGESKKLNFGKRKNGKASKTRGPKDKPVSAYRGQGK*
Ga0105747_10645171	3300007974	Estuary Water	MAKATGNSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK*
Ga0105747_10747671	3300007974	Estuary Water	MAKAKLTSGKATFGKRKGGKARKSSGPKDAPKSKYRGQGK*
Ga0105748_100586773	3300007992	Estuary Water	MAKSSGESKKLNFGKRKNGKASKTRGPKDKPVSAYRGQGK*
Ga0105748_101481083	3300007992	Estuary Water	MAKSIGNATKQTFGKRKGGKARKSSGPKDAPKSKYRGQGK*
Ga0114340_10950783	3300008107	Freshwater, Plankton	MAKGKITDSKKITFGKRKGGKAAKSRGPKDKSVSQYRGQGR*
Ga0114341_103663233	3300008108	Freshwater, Plankton	FQMAKIKSSESRKTTFGKRKGGKAAKSRGPKDKPVSKYRGQGR*
Ga0114343_10076269	3300008110	Freshwater, Plankton	MSLSSANTRKLTFGRRKKGQSRKSSGPKAKKYSRYRGQGK*
Ga0114346_12048931	3300008113	Freshwater, Plankton	MAKASRGEAKKVTFGKRRTGKAKKFSGPKDKDVSKYRGQGR*
Ga0114350_10030022	3300008116	Freshwater, Plankton	MAKSIGNATKTTFGKRKGGKARKSSGPKDAPKSKYRGQGK*
Ga0114364_10001777	3300008267	Freshwater, Plankton	MAKTLSSANKTTFGKRKGGKPKKGKGPKEKSVSKYRGQGK*
Ga0114364_10096133	3300008267	Freshwater, Plankton	MAKTKSADSKKITFGKRKGGKAAKSRGPKDKPVSKYRGQG*
Ga0114364_10264832	3300008267	Freshwater, Plankton	MAKTKSSDSKKITFGKRKGGKAAKSRGPKDKAVSKYRGQG*
Ga0114880_10299014	3300008450	Freshwater Lake	MAKATSNNNKQSFGKRKGGKAKKTLSPKDKQISKYKGQGRG*
Ga0114880_10411783	3300008450	Freshwater Lake	MAKGSKNESRKISFGKRKGGKAAKVRGPKAKKVSAYRGQGR*
Ga0114880_11641301	3300008450	Freshwater Lake	MAKIKSTDSKKTTFGKRKGGKAQKSRGPKDKPVSKYQGQGR*
Ga0102816_10219822	3300008999	Estuarine	MAKAKVGDSRKITFGKRRSGRLRKTSGPKCKKVSKYRGQGR*
Ga0105093_100231738	3300009037	Freshwater Sediment	MAKVTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0102909_10912851	3300009050	Estuarine	TCIIFKKTTMAKVKSDSRKISFGKLKTGRAYKTSGPKAKKISKYRGQGR*
Ga0114973_1000158714	3300009068	Freshwater Lake	MARALSSDSRKVTFGSRKKGKAKKGSGPKDKSVSKYRAQGR*
Ga0105090_104553272	3300009075	Freshwater Sediment	MAKATGTSTKLNFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0105098_104323142	3300009081	Freshwater Sediment	MAKVTGNSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0105103_100781005	3300009085	Freshwater Sediment	VAKAVSNSNKVTFGKRKGGKAKKRKSPRDKSVSKPRGQGNV*
Ga0105103_101941713	3300009085	Freshwater Sediment	MAKATGTSTKLNFGKRKGGKAQKTRGPKQKSVSKYRGQ*
Ga0105103_103833823	3300009085	Freshwater Sediment	MAKAVSNSNKVTFGKRKGGKAKKRKSPRDKSVSKPRGQGNV*
Ga0114962_1000001961	3300009151	Freshwater Lake	MAKTTTGANKITFGARKSGKSKKSSGPKDKKVSKYVGQG*
Ga0114962_1000054954	3300009151	Freshwater Lake	MARSISSDSRKLTFGARKKGKAKKGSGPKDKAVSKYRAQGR*
Ga0114962_101331902	3300009151	Freshwater Lake	MAKTTGDSRKTTFGKRKGGKAKKSKGPKEKNVSKYRSQGR*
Ga0114962_106565583	3300009151	Freshwater Lake	MAKVTASSVKSTFGKRKGGKAQKRKGPKDKAVSKYKGQGKL*
Ga0105092_101507963	3300009157	Freshwater Sediment	VAKAVSNSNKVTFGKRKGGKAKKRKSPRDKAVSKPRGQGNV*
Ga0114978_100319464	3300009159	Freshwater Lake	MAKVTGTSTKLSFGKRKGGKAQKTRGPKQKAVSQYRGQGK*
Ga0114970_1000012333	3300009163	Freshwater Lake	MAKVLGNSTKLSFGKRKSGKAKKSRSPKDKLVSKYRGQGK*
Ga0105102_100116136	3300009165	Freshwater Sediment	MAKATGTSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK*
Ga0105102_104033752	3300009165	Freshwater Sediment	MAKTKSSSNNKVSFGKRKGGKASKCKGPKDKNKSTYRGQGKLI*
Ga0105097_106067152	3300009169	Freshwater Sediment	MAKLKSAGGSVKISFGKRKGGKASKTSGPKAKPTKPYRGQGK*
Ga0114974_100081753	3300009183	Freshwater Lake	MAKVTGNSTKLSFGKRKGGRAQKTRGPKQKAVSHYRGQGK*
Ga0114964_1000132924	3300010157	Freshwater Lake	MAKTTGTSTKITFGTRKGGKAKKSSGPKDKKVSKYVGQGK*
Ga0114964_100221662	3300010157	Freshwater Lake	MAKSKGVSSNKVTFGKRKGGKASKFKGPKDKPVSKYIGQGK*
Ga0114960_105233041	3300010158	Freshwater Lake	KVTGSTIKITFGKRKTGKSKKRKGPKDKPVSKYIGQGN*
Ga0129333_100135328	3300010354	Freshwater To Marine Saline Gradient	MAKSVSSSRKTTFGKRKSGKRIKSRGPKDKAVSKYRGQGK*
Ga0129333_100383189	3300010354	Freshwater To Marine Saline Gradient	MAKPKAGESRKISFGKRKGGRPAKSKGPKDKKVSKYRGQG*
Ga0129333_102236972	3300010354	Freshwater To Marine Saline Gradient	MAKGKLTDIKKISFGKRKGGKAAKSSGPKDKAVSRYRGQGR*
Ga0129333_102843933	3300010354	Freshwater To Marine Saline Gradient	MAKISGAANKITFGTRKGRKARKSRGPKDKSISKYRGQGR*
Ga0129333_103218954	3300010354	Freshwater To Marine Saline Gradient	MAKGKLGDVKKVTFGKRKGGKPAKSSGPKAKAVSK
Ga0129333_107993343	3300010354	Freshwater To Marine Saline Gradient	MAKQTTQSIKTTFGKRKVGRAAKRSGPKVKHIKKYRGQGR*
Ga0129333_108450832	3300010354	Freshwater To Marine Saline Gradient	MAKGKLGDVKKVTFGKRKGGKAAKSRGPKDKSVSRYRAQGR*
Ga0133913_103267613	3300010885	Freshwater Lake	MAKVTASSIKATFGKRKSGKARKNKGPKDKPVSKYIGQGKL*
Ga0133913_105149711	3300010885	Freshwater Lake	SIMAKSKGVSSNKVTFGKRKGGKASKFKGPKDKPVSKYIGQGK*
Ga0133913_114939051	3300010885	Freshwater Lake	MAKVTGSTIKITFGKRKTGKSKKRKGPKDKPVSKYIGQGN*
Ga0153801_10518523	3300012017	Freshwater	SKSSGDSRKVNFGKRKGGKARKTSGPKDKKVSKYVGQGK*
Ga0153801_10543072	3300012017	Freshwater	MAKSIGNATKTTFGKHKGGKARKSSGPKDAPKSKYRGQGK*
Ga0164293_101304974	3300013004	Freshwater	MAKVIASSIKSTFGKRKGGKAQKRKGPKDKAVSKYKGQGKL*
(restricted) Ga0172364_103803111	3300013129	Sediment	MAKSIGRATKTTFGKRKGGKARKSSGPKDAPKSKYRGQGK*
Ga0177922_108111682	3300013372	Freshwater	MAGKASKQSNNKVSFGKRKGGKAAKVRGPKAKKVSAYRGQGR*
(restricted) Ga0172376_102863634	3300014720	Freshwater	MAKSKIGTNNKLTFGKRKTGKAKKTSGPKDKLVSKYRGQGKIG*
(restricted) Ga0172376_106024891	3300014720	Freshwater	INNIIMAKSIGRATKTTFGKRKGGKARKSSGPKDAPKSKYRGQGK*
Ga0134315_10441353	3300014962	Surface Water	MAKGSKSSESRKITFGKRRVGKAKKSKGPKDKNVSPYRGQG*
Ga0181344_10104514	3300017754	Freshwater Lake	MAKATGTSTKLNFGKRKGGKAQKTRGPKQKSVSKYRGQGK
Ga0181343_10306092	3300017766	Freshwater Lake	MKKGEQFKITFGKRRKGKASKRKGPKDKPVSKYRGQGR
Ga0181343_11074812	3300017766	Freshwater Lake	MAKATGNSIKLNFGKRKGGKAQKTRGPKQKAVSKYRGQGK
Ga0188848_10054823	3300018775	Freshwater Lake	MAKAKVGDSKKITFGKRRTGRLRKRSGPKAKKVSKYRGQGK
Ga0181359_11181192	3300019784	Freshwater Lake	MAKATGTSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK
Ga0181359_11209682	3300019784	Freshwater Lake	MAKSIGNATKQTFGKRKGGKARKSSGPKDAPKSKYRGQGK
Ga0194110_107500393	3300020084	Freshwater Lake	MAKSTRGDAKKVTFGKRRVGKARKFKGPKDKPVSKYRGQGR
Ga0211732_141410811	3300020141	Freshwater	MAKVKSDSRKISFGKRKGGKAYKTSGPKAKKISTYRGQGR
Ga0211736_101875746	3300020151	Freshwater	FMAKATGTSTKLSFGKRKGGKSQKTRGPKQKSVSHYRGQGK
Ga0211736_104982174	3300020151	Freshwater	MAKVKSDSRKITFGKRRKGKYAKCSGPKAKKVSKYRGQGR
Ga0211736_1083980825	3300020151	Freshwater	MAKGKSDSRKISFGKRKGGKASKTSGPRDKAVSKYRGQGR
Ga0211734_113170422	3300020159	Freshwater	MAKATGTSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK
Ga0211726_103452653	3300020161	Freshwater	MAKSVNSNKLTFGKRKSGKAKKTSGPKDAPTKIYRGQGKKH
Ga0211726_108652632	3300020161	Freshwater	MAKVKSDSRKINFGKRKGGKASKTQGPKDKPVKKYRGQGK
Ga0194037_11753412	3300020164	Anoxic Zone Freshwater	MAKTTTGANKVIFGSRKGGKSKKSSGPKDKKVSKYVGQGK
Ga0211731_115259483	3300020205	Freshwater	MARALSSDSRKVTFGVRKKGKAKKGHGPKDKSVSKYRAQGR
Ga0194125_107114643	3300020222	Freshwater Lake	KSSGESRKIIFGRRKGGKARKYSGPKERKASKYRGQGR
Ga0194042_11437632	3300020229	Anoxic Zone Freshwater	MAKTTGDSRKTTFGKRKGGKAKKSKGPKEKNVSKYRSQGR
Ga0207936_10020832	3300020512	Freshwater	MAKSKSSGDSRKVNFGKRKGGKARKTSGPKDKKVSKYVGQGK
Ga0208721_10273862	3300020518	Freshwater	MAKSVNSNKLTFGKRKGGKAKKTSGPKDAPTKIYRGQGKKH
Ga0208082_10303892	3300020563	Freshwater	MAKITNANKVSFGKRKGGKASKSRGPKDKRVSKYIGQGK
Ga0214170_100021621	3300020731	Freshwater	MAKGSVTNANKVTFGSRKGGKAKKSSGPKDKKVSKYIGQGK
Ga0194055_1000341111	3300021079	Anoxic Zone Freshwater	MAKTVSDSRKVTFGARKSGKAFKSKGPKDKKVSKYRGQGR
Ga0214206_10088372	3300021131	Freshwater	MAKSKSTDSRKISFGKRKGGKAAKTSGPKDKPVKKYRGQGK
Ga0214192_10099216	3300021142	Freshwater	MAKAVGNTRKLTFGKRKGGKAKKSSGPKDKKVSKYRSQGR
Ga0194047_1000016216	3300021354	Anoxic Zone Freshwater	MAKATSSVKKISFGKRKGGKASKTKGPNDKAVSKYRGQGK
Ga0222714_100238582	3300021961	Estuarine Water	MAKSTRGDAKKVTFGKRRTGKAQKFRGPKDKPVSKYRGQGR
Ga0181353_10185214	3300022179	Freshwater Lake	MAKSKLDSHKVTFGKRKGGKAKKHNGPKEAPKSKYKGQGR
Ga0181353_10413332	3300022179	Freshwater Lake	MAKSIRSESNKISFGKRKGGKAQKTKGPKDKPTKKYVGQGR
Ga0181351_11648642	3300022407	Freshwater Lake	MAKPKAGDARKIQFGKRKGGKPIKSKGPKDKKISKYRGQGK
Ga0181351_12753281	3300022407	Freshwater Lake	MAKATGNSTKLNFGKRKGGKAQKTRGPKQKAVSKYRGQ
Ga0214917_101982741	3300022752	Freshwater	MAKSTQELRKINFGRRKGGKARKSRGPKDKKVSKYRSQGR
Ga0214919_100523692	3300023184	Freshwater	VAKAKSTSNNKISFGKRKGGKPAKTSGPKAKPVKQYRGQGR
Ga0244775_101195194	3300024346	Estuarine	MAKSKAIGDVKKVTFGARKTGKAKKGSGPKDKSVSKYRGQGR
Ga0244775_112031002	3300024346	Estuarine	MAKSKAVSSIKATFGKRKGGKAQKRSGPKDKPVSKYIGQGK
Ga0244775_112780322	3300024346	Estuarine	MAKVKSDSRKISFGKRKGGKASKTSGPKAKAVGKYRGQGR
Ga0208916_103061182	3300025896	Aqueous	MAKTISSIKATFGKRKGGKAQKRKGPKDKAVSKYKGQGKL
Ga0208797_10371201	3300027186	Estuarine	MAKAKVGDSRKITFGKRRSGRLRKTSGPKAKKVSKYRGQG
Ga0208173_10726552	3300027244	Estuarine	MAKVKSDSRKISFGKRKTGRAYKTSGPKAKKISKYRGQG
Ga0208975_100302610	3300027659	Freshwater Lentic	MAKGTFSANKIVFGKRKGGKPAKSKGPKDKSVSKYRGQGKA
Ga0208975_10332821	3300027659	Freshwater Lentic	MAKATGTSTKLSFGKRKGGKAQKTRGPKQKSVSQYRGQGK
Ga0209704_12217442	3300027693	Freshwater Sediment	MAKVTGNSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK
Ga0209188_1000167117	3300027708	Freshwater Lake	MARSISSDSRKLTFGARKKGKAKKGSGPKDKAVSKYRAQGR
Ga0209599_100608951	3300027710	Deep Subsurface	MAKVKSDSRKVSFGKRKGGKATKTSGPKAKKISKYRGQG
Ga0209190_100010240	3300027736	Freshwater Lake	MAKVLGNSTKLSFGKRKSGKAKKSRSPKDKLVSKYRGQGK
Ga0209593_100048204	3300027743	Freshwater Sediment	MAKAVSNSNKVTFGKRKGGKAKKRKSPRDKSVSKPRGQGNV
Ga0209189_100003886	3300027747	Freshwater Lake	MAKTTTGANKITFGARKSGKSKKSSGPKDKKVSKYVGQG
Ga0209296_10463212	3300027759	Freshwater Lake	MAKVTGNSTKLSFGKRKGGRAQKTRGPKQKAVSHYRGQGK
Ga0209088_100847294	3300027763	Freshwater Lake	MAKTKVGDSRKVTFGKRKGGRLRKSNGPKAKKVSKYR
Ga0209134_102960702	3300027764	Freshwater Lake	MARAISSDSRKVTFGVRKKGKAKKGHGPKEKSVSKYRAQGR
Ga0209500_1000984611	3300027782	Freshwater Lake	MAKVTGTSTKLSFGKRKGGKAQKTRGPKQKAVSQYRGQGK
Ga0209972_100443751	3300027793	Freshwater Lake	MAKGKSLGESRKIVFGKRKGGKAKKSSGPKDKKVSKYRGQ
Ga0209229_100720551	3300027805	Freshwater And Sediment	MAGKVKAGDAKKVTFGVRKGGKAQKLRGPKQKKVSKYRGQGR
Ga0209229_102213301	3300027805	Freshwater And Sediment	MAKAKGSKAGESRKVTFGKRKGGKAAKSRGPKDKAVS
Ga0209990_10000038130	3300027816	Freshwater Lake	MAKGKLTDSRKITFGKRKGGKAAKSRGPKDKSVSKYRAQGR
Ga0209253_101542412	3300027900	Freshwater Lake Sediment	MAKATTTSNKINFGKRKGGKYKKSSGPKDKNVSRYRGQGK
Ga0209253_102339342	3300027900	Freshwater Lake Sediment	MAKVKSDSRKISFGKRKGGKAKKTSGPKVKAVSKYRGQGR
Ga0209079_100529622	3300027972	Freshwater Sediment	MAKVTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK
Ga0247723_10034711	3300028025	Deep Subsurface Sediment	MAKATGNSTKLNFGKRKGGKAQKTRGPKQKAVSKYRGQGK
Ga0304729_11119892	3300028392	Freshwater Lake	MAKSKGVSSNKVTFGKRKGGKASKFKGPKDKPVSKYIGQGK
Ga0315293_100319056	3300031746	Sediment	MAKAIGISTKLTFGKRKGGKARKSKKAKGKNVSEYRGQGKLNR
Ga0315907_105936581	3300031758	Freshwater	MKKSTASNKPISFGKRKGGKAAKSRGPKDKKVSKYRG
Ga0315907_111029273	3300031758	Freshwater	TSSTKLTFGKRKVGKAKKRLGPKDKNVKRYNKQGR
Ga0315899_106128352	3300031784	Freshwater	MAKGKGSSDRQKISFGKRKGGKAAKTSGPKDKNKKAYRGQGK
Ga0315900_105803022	3300031787	Freshwater	MAKVKSTDSKKTTFGKRKGGKAQKSRGPKDKPVSKYQGQGR
Ga0315909_104786062	3300031857	Freshwater	MAKTLSSANKTTFGKRKGGKPKKGKGPKEKSVSKYRGQGK
Ga0315294_104077422	3300031952	Sediment	MAKVKAISSIKATFGKRKGGKAQKRKGPKDKAVSKYVGQGK
Ga0315294_108247772	3300031952	Sediment	MAKAKAISSTKLTFGKRKGGKAQKRSGPKDKPVSKYIGQGK
Ga0315284_100868276	3300032053	Sediment	MARTIANSAYKVNFGRRKSGKAKKSRGPKEKRVSKYRSQGR
Ga0315284_108588323	3300032053	Sediment	MAKAKSIGASTKLSFGKRKGGKAKKSSSPKDKNVSKYRGQGK
Ga0315284_109712181	3300032053	Sediment	MAKSKGVSSNKVTFGKRKGGKASKFKGPKDKSVSKYIGQGK
Ga0315273_102164552	3300032516	Sediment	MAKAKAISSIKATFGKRKGGKAQKRKGPKDKSVSKYVGQGKL
Ga0334977_0011232_3953_4066	3300033978	Freshwater	MKNNSDKINFGRRKNGKARKSSGPKDKNKSKNRGQGK
Ga0334981_0002956_9278_9406	3300033980	Freshwater	MAKSKSSGDSRKISFGKRKGGKARKTSGPKDKKVSKYVGQGK
Ga0334982_0000351_10635_10757	3300033981	Freshwater	MKKGSSDSRKVIFGKRKGRRARKTKGPKDKAVSKYRGQGK
Ga0334994_0076296_11_136	3300033993	Freshwater	MKMASKESSIKISFGKRREGKHSKTSGPKAGNVKKYKGQGR
Ga0334986_0317313_702_818	3300034012	Freshwater	MAKSKAADSRKITFGKRKGGKATKSRGPKDKNVSKYQGQ
Ga0334991_0194995_589_708	3300034013	Freshwater	MAKSVGNSNKVSFGKRKGGKAQKTKGPKDKPTKKNVGQG
Ga0334985_0037675_3299_3424	3300034018	Freshwater	MAKVKSTDSRKTTFGKRKGGKAAKSRGPKDKPVSKYRGQGK
Ga0334987_0108940_1645_1770	3300034061	Freshwater	MAKIKVSNNKPTFGKRKGGKAAKSSGPKSKAVSKYRGQGRL
Ga0334987_0369556_2_112	3300034061	Freshwater	MAKATGNSIKLSFGKRKGGKAQKTRGPKQKAVSQYRG
Ga0335031_0158180_172_300	3300034104	Freshwater	MAKLKSTGSNKPTSFGKRKGGKATKSKGPKVKGVSKYRGQGK
Ga0335068_0070149_1897_2010	3300034116	Freshwater	MAKSKALGDSRKITFGKRKGGKAKKSSGPKDRKVSKYR
Ga0335053_0017026_2_115	3300034118	Freshwater	MAKSKAADSRKITFGKRKGGKATKSRGPKDKNVSKYQG
Ga0335053_0369904_3_122	3300034118	Freshwater	KSKAADSRKITFGKRKGGKATKSRGPKDKNVSKYQGQGR
Ga0335049_0571531_401_523	3300034272	Freshwater	MAKVTGTSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK
Ga0335052_0048348_2227_2355	3300034279	Freshwater	MAKLKSTGSNKPTSFGKRKGGKATKSKGPKVKGVSKYKGQGK
Ga0335039_0473377_136_255	3300034355	Freshwater	MAKTVNSNKLTFGKRKGNKAKKSSGPKDAPKSKYRGQGK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters