Scaffold Ga0079955_123763

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079955_123763

Scaffold Ga0079955_123763

Overview

Basic Information
Taxon OID	3300005804 Open in IMG/M
Scaffold ID	Ga0079955_123763 Open in IMG/M
Source Dataset Name	Freshwater sediment microbial communities from Rio Mameyes, Puerto Rico - dichloromethane (DCM) enrichment
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Tennessee
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	974
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Degradation Of Dichloromethane (Dcm)

Source Dataset Sampling Location
Location Name	Puerto Rico
Coordinates	Lat. (^o)	18.21439	Long. (^o)	-65.461	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015621	Metagenome / Metatranscriptome	253	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079955_1237633	F015621	GGA	MSLAELKENVLALPASERHEFVTWMNRLEADYGDVPGEALDQLAAEIWDQDDRHAPPTHPTR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.