Basic Information | |
---|---|
Taxon OID | 3300005804 Open in IMG/M |
Scaffold ID | Ga0079955_123763 Open in IMG/M |
Source Dataset Name | Freshwater sediment microbial communities from Rio Mameyes, Puerto Rico - dichloromethane (DCM) enrichment |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Tennessee |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 974 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Degradation Of Dichloromethane (Dcm) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Puerto Rico | |||||||
Coordinates | Lat. (o) | 18.21439 | Long. (o) | -65.461 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015621 | Metagenome / Metatranscriptome | 253 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079955_1237633 | F015621 | GGA | MSLAELKENVLALPASERHEFVTWMNRLEADYGDVPGEALDQLAAEIWDQDDRHAPPTHPTR* |
⦗Top⦘ |