NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079955_101514

Scaffold Ga0079955_101514


Overview

Basic Information
Taxon OID3300005804 Open in IMG/M
Scaffold IDGa0079955_101514 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Rio Mameyes, Puerto Rico - dichloromethane (DCM) enrichment
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Tennessee
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12158
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (15.79%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Degradation Of Dichloromethane (Dcm)

Source Dataset Sampling Location
Location NamePuerto Rico
CoordinatesLat. (o)18.21439Long. (o)-65.461Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020363Metagenome / Metatranscriptome224Y

Sequences

Protein IDFamilyRBSSequence
Ga0079955_10151410F020363N/AMWRWRRVAMARVFALVVRCSDMKLFVYCRVGKNRDTRRESPAGAGPGRTADHLTILFSQEVLAVRSANDIYRPVSTSY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.