Scaffold Ga0079639_1099693

Overview

Basic Information

• Taxon OID: 3300005800
• Scaffold ID: Ga0079639_1099693
• Source Dataset Name: Sediment microbial communities of hot springs in Rotorua, New Zealand ? Tikitere hot spring, NZ13
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oak Ridge National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 594
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Archaeoglobi → Archaeoglobales → unclassified Archaeoglobales → Archaeoglobales archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Thermal Hot Spring → Sediment Microbial Communities Of Hot Springs In Rotorua, New Zealand

Source Dataset Sampling Location

• Location Name: Rotorua, NZ
• Coordinates
  • Lat. (^o): -38.0631325
  • Long. (^o): 176.360798

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103293	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079639_10996931	F103293	AGGAGG	MGYIPEDLQKLEELPAPYEIFEFVPGVPAYFEVTDYKIGRIAIHPRWPGAPEEKTIVAIRLYVTPKCKPTSPPYYDITPARLVYALAPILASGKWRGYWLRIVRDIPGPKAHFQVSIVTGPEE*