| Basic Information | |
|---|---|
| Taxon OID | 3300005800 Open in IMG/M |
| Scaffold ID | Ga0079639_1006524 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities of hot springs in Rotorua, New Zealand ? Tikitere hot spring, NZ13 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oak Ridge National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3413 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Thermal Hot Spring → Sediment Microbial Communities Of Hot Springs In Rotorua, New Zealand |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rotorua, NZ | |||||||
| Coordinates | Lat. (o) | -38.0631325 | Long. (o) | 176.360798 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103293 | Metagenome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079639_10065243 | F103293 | GGAGG | MGYIPEDLQKLEELPAPYEIYEFVPGVPAYFEVTDYKIGRIAIHPRWPGAPEEKTIVAIRLYVTPKCKPTSPPYYDITPARLVYALAPILASGKWRGYWLRIVRDIPGPKAHFQVSIVTGPEE* |
| ⦗Top⦘ |