Scaffold Ga0079639_1006524

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079639_1006524

Scaffold Ga0079639_1006524

Overview

Basic Information
Taxon OID	3300005800 Open in IMG/M
Scaffold ID	Ga0079639_1006524 Open in IMG/M
Source Dataset Name	Sediment microbial communities of hot springs in Rotorua, New Zealand ? Tikitere hot spring, NZ13
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oak Ridge National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3413
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Thermal Hot Spring → Sediment Microbial Communities Of Hot Springs In Rotorua, New Zealand

Source Dataset Sampling Location
Location Name	Rotorua, NZ
Coordinates	Lat. (^o)	-38.0631325	Long. (^o)	176.360798	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103293	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079639_10065243	F103293	GGAGG	MGYIPEDLQKLEELPAPYEIYEFVPGVPAYFEVTDYKIGRIAIHPRWPGAPEEKTIVAIRLYVTPKCKPTSPPYYDITPARLVYALAPILASGKWRGYWLRIVRDIPGPKAHFQVSIVTGPEE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.