Scaffold Ga0079492_100331

Overview

Basic Information

• Taxon OID: 3300005796
• Scaffold ID: Ga0079492_100331
• Source Dataset Name: Subglacial sediment microbial community from Lake Whillans, Antarctica - at 14-16 cm depth
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6078
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica

Source Dataset Sampling Location

• Location Name: West Antarctica
• Coordinates
  • Lat. (^o): -84.24
  • Long. (^o): -153.694

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041287	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079492_1003317	F041287	AGGAGG	MEVCFKCRNQADFICPDCGTKVCIAHAELRYSGPHRGLKSRYMCPICWKMKRVVLNESMLNAREYKPKLYVFSSRKIGI*