Scaffold Ga0079404_111022

Overview

Basic Information

• Taxon OID: 3300005793
• Scaffold ID: Ga0079404_111022
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean. Combined Assembly of Gp0107627, Gp0107629, Gp0119879, Gp0119880, Gp0119881, Gp0107619
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1040
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Axial seamount, northeast pacific ocean
• Coordinates
  • Lat. (^o): 45.933231
  • Long. (^o): -130.013645
  • Depth (m): 1542

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038276	Metagenome	166	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0079404_1110222	F038276	AGTAG	MNLDFLLRLTNYVNIDKQIYLAVIKQFLTVLVIINHACVLLHGNHNYKDVFYDRLSNQYIRNACDFHNLHISYNNLGLVLEKFLLYIKIINNKV*