Basic Information | |
---|---|
Taxon OID | 3300005786 Open in IMG/M |
Scaffold ID | Ga0078433_112564 Open in IMG/M |
Source Dataset Name | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten I |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Center for Biotechnology (CeBiTec), Bielefeld Univeristy |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 621 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Fram Strait | |||||||
Coordinates | Lat. (o) | 78.153207 | Long. (o) | 5.975413 | Alt. (m) | Depth (m) | 1200 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F099818 | Metagenome / Metatranscriptome | 103 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0078433_1125641 | F099818 | N/A | EGSVMGLERRVQVIAVELGPTGHAGRSPMVQRKAAAFV* |
⦗Top⦘ |