Scaffold Ga0078433_101588

Overview

Basic Information

• Taxon OID: 3300005786
• Scaffold ID: Ga0078433_101588
• Source Dataset Name: Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten I
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Center for Biotechnology (CeBiTec), Bielefeld Univeristy
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1373
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities

Source Dataset Sampling Location

• Location Name: Fram Strait
• Coordinates
  • Lat. (^o): 78.153207
  • Long. (^o): 5.975413
  • Depth (m): 1200

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093897	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0078433_1015884	F093897	AGGA	VKLGFYISMGVAIAGLVVGFILLNDIQQEKESQLVWMQKIPTQCNDVWSEEYNEFYKINPEMREFSKEESKEILENIIKSHYEKQGINVVDLNLQFDVYEGMRCQACNCLGWDKLSIEIPEKQLELIPENEGWEPKS*