Scaffold Ga0078431_134999

Overview

Basic Information

• Taxon OID: 3300005784
• Scaffold ID: Ga0078431_134999
• Source Dataset Name: Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IV
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Center for Biotechnology (CeBiTec), Bielefeld Univeristy
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 533
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities

Source Dataset Sampling Location

• Location Name: Fram Strait
• Coordinates
  • Depth (m): 2500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087217	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0078431_1349991	F087217	GGAG	MMRFSSALIAAASLAFAFLVMPGAGHAAELPEGVTIDLIAEYPSKTAGIEKVLFRKIALKPGASWSFTVPAQSLCQAIKGELEVEDHTAGKTVVFKAGDRWDTSPGHEVTLSNKGTVDHEHLFYTL