Scaffold Ga0077776_1160506

Overview

Basic Information

• Taxon OID: 3300005753
• Scaffold ID: Ga0077776_1160506
• Source Dataset Name: Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2529
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Acroporidae → Acropora (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Mid-Cayman Rise
• Coordinates
  • Lat. (^o): 18.375
  • Long. (^o): -81.797
  • Depth (m): 2370

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043217	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0077776_11605062	F043217	GGA	VVIELRVVQFWSEIKLAITNRTPATRSCNFVIARLISDQIALHSVQLHYKFQAEYPE