Scaffold Ga0077776_1083906

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0077776_1083906

Scaffold Ga0077776_1083906

Overview

Basic Information
Taxon OID	3300005753 Open in IMG/M
Scaffold ID	Ga0077776_1083906 Open in IMG/M
Source Dataset Name	Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2252
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean

Source Dataset Sampling Location
Location Name	Mid-Cayman Rise
Coordinates	Lat. (^o)	18.375	Long. (^o)	-81.797	Alt. (m)		Depth (m)	2370
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023622	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0077776_10839063	F023622	GAGG	MKTFKEFQGETPTQIVEQVYFKIRIPDMSTMFMKASSESAVKLDMRQKLKPDVVKEVSIERVTKAEMRKIYRAMGQGKEDEKEPAEEK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.