| Basic Information | |
|---|---|
| Taxon OID | 3300005753 Open in IMG/M |
| Scaffold ID | Ga0077776_1027646 Open in IMG/M |
| Source Dataset Name | Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1885 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mid-Cayman Rise | |||||||
| Coordinates | Lat. (o) | 18.375 | Long. (o) | -81.797 | Alt. (m) | Depth (m) | 2370 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005815 | Metagenome / Metatranscriptome | 389 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0077776_10276462 | F005815 | GGAG | MTMEITRLTTYWTTHEADTVIDLLDRLRDALWETYGDQIIQIHRETCDDGIPDPNQCELPFNDDIPF* |
| ⦗Top⦘ |