Scaffold Ga0076924_1165152

Overview

Basic Information

• Taxon OID: 3300005747
• Scaffold ID: Ga0076924_1165152
• Source Dataset Name: Seawater microbial communities from Vineyard Sound, MA, USA - control T14
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5202
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. 63ED37-2 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 41.4417
  • Long. (^o): -70.7744

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083752	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0076924_11651527	F083752	N/A	MSLLDKVNIIISSNEEVYWNNEFQIQLYMSKKYLEAFKEAALIECGEFDENFPPPTHIVADLAKNFIKDHDLFLSDFFEAIQILSKGLKLNVHKL*