NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083752

Metagenome / Metatranscriptome Family F083752

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083752
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 94 residues
Representative Sequence MSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Number of Associated Samples 96
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.50 %
% of genes near scaffold ends (potentially truncated) 36.61 %
% of genes from short scaffolds (< 2000 bps) 86.61 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.857 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(34.821 % of family members)
Environment Ontology (ENVO) Unclassified
(55.357 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(91.071 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.62%    β-sheet: 10.42%    Coil/Unstructured: 48.96%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF02169LPP20 31.25
PF13365Trypsin_2 1.79
PF00078RVT_1 0.89
PF06013WXG100 0.89
PF00656Peptidase_C14 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG4249Uncharacterized conserved protein, contains caspase domainGeneral function prediction only [R] 0.89
COG4842Secreted virulence factor YukE/EsxA, WXG100 familyDefense mechanisms [V] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.86 %
UnclassifiedrootN/A32.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000224|SI34jun09_10mDRAFT_1009970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1943Open in IMG/M
3300001349|JGI20160J14292_10094014Not Available1096Open in IMG/M
3300001354|JGI20155J14468_10234242Not Available538Open in IMG/M
3300001355|JGI20158J14315_10177408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium626Open in IMG/M
3300001941|GOS2219_1016696Not Available1764Open in IMG/M
3300004097|Ga0055584_100350803All Organisms → cellular organisms → Bacteria → Proteobacteria1521Open in IMG/M
3300004097|Ga0055584_102645773Not Available504Open in IMG/M
3300004279|Ga0066605_10036782All Organisms → cellular organisms → Bacteria → Proteobacteria2292Open in IMG/M
3300004280|Ga0066606_10100652All Organisms → cellular organisms → Bacteria → Proteobacteria1092Open in IMG/M
3300005239|Ga0073579_1283186Not Available833Open in IMG/M
3300005747|Ga0076924_1165152All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. 63ED37-25202Open in IMG/M
3300007280|Ga0101452_124911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2393Open in IMG/M
3300009001|Ga0102963_1000593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria15633Open in IMG/M
3300009058|Ga0102854_1169244Not Available626Open in IMG/M
3300009071|Ga0115566_10737441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium544Open in IMG/M
3300009172|Ga0114995_10253377Not Available972Open in IMG/M
3300009434|Ga0115562_1202903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium709Open in IMG/M
3300009436|Ga0115008_10176107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1544Open in IMG/M
3300009442|Ga0115563_1037363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2429Open in IMG/M
3300009467|Ga0115565_10095234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1409Open in IMG/M
3300009467|Ga0115565_10274110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium769Open in IMG/M
3300009472|Ga0115554_1297751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium639Open in IMG/M
3300009495|Ga0115571_1043874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2104Open in IMG/M
3300009495|Ga0115571_1104746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1223Open in IMG/M
3300009497|Ga0115569_10166766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1042Open in IMG/M
3300009497|Ga0115569_10296974Not Available714Open in IMG/M
3300009498|Ga0115568_10408173Not Available588Open in IMG/M
3300009507|Ga0115572_10027855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium3811Open in IMG/M
3300009507|Ga0115572_10271371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium966Open in IMG/M
3300009507|Ga0115572_10323394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium872Open in IMG/M
3300009508|Ga0115567_10084769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2243Open in IMG/M
3300009508|Ga0115567_10900484Not Available525Open in IMG/M
3300020165|Ga0206125_10043485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2262Open in IMG/M
3300020347|Ga0211504_1021611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1712Open in IMG/M
3300020352|Ga0211505_1073435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium824Open in IMG/M
3300020385|Ga0211677_10011795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4726Open in IMG/M
3300020388|Ga0211678_10119098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1154Open in IMG/M
3300021085|Ga0206677_10093403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1436Open in IMG/M
3300021085|Ga0206677_10185324Not Available902Open in IMG/M
3300021169|Ga0206687_1742793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium770Open in IMG/M
3300021185|Ga0206682_10082780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1635Open in IMG/M
3300021185|Ga0206682_10166395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1027Open in IMG/M
3300021350|Ga0206692_1229327Not Available1047Open in IMG/M
3300021365|Ga0206123_10204965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium875Open in IMG/M
3300021365|Ga0206123_10364866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium601Open in IMG/M
3300021371|Ga0213863_10035173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2724Open in IMG/M
3300021371|Ga0213863_10241424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium777Open in IMG/M
3300021371|Ga0213863_10393753Not Available561Open in IMG/M
3300021957|Ga0222717_10115004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1671Open in IMG/M
3300021958|Ga0222718_10038617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium3124Open in IMG/M
(restricted) 3300022920|Ga0233426_10026156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium3080Open in IMG/M
(restricted) 3300022920|Ga0233426_10074400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1553Open in IMG/M
(restricted) 3300022920|Ga0233426_10094452Not Available1330Open in IMG/M
(restricted) 3300022931|Ga0233433_10029777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium3144Open in IMG/M
3300023694|Ga0228683_1006116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1204Open in IMG/M
3300024191|Ga0228636_1055443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium938Open in IMG/M
3300024230|Ga0228638_1093143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium743Open in IMG/M
3300024230|Ga0228638_1137093Not Available571Open in IMG/M
3300024231|Ga0233399_1067613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium888Open in IMG/M
3300024235|Ga0228665_1118524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium545Open in IMG/M
3300024237|Ga0228653_1071182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium766Open in IMG/M
3300024244|Ga0228678_1071466Not Available666Open in IMG/M
3300024248|Ga0228676_1111040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium591Open in IMG/M
3300024293|Ga0228651_1136738Not Available539Open in IMG/M
3300024314|Ga0228657_1095898Not Available595Open in IMG/M
3300024321|Ga0228626_1085364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium703Open in IMG/M
3300024328|Ga0228635_1110667Not Available615Open in IMG/M
3300024415|Ga0228662_1053648Not Available1023Open in IMG/M
3300025658|Ga0209659_1106334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium903Open in IMG/M
3300025699|Ga0209715_1094263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1122Open in IMG/M
3300025849|Ga0209603_1021858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium4003Open in IMG/M
3300025876|Ga0209223_10321130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium693Open in IMG/M
3300025880|Ga0209534_10394288Not Available602Open in IMG/M
3300025886|Ga0209632_10161104Not Available1225Open in IMG/M
3300025890|Ga0209631_10409812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium626Open in IMG/M
3300025894|Ga0209335_10342094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium622Open in IMG/M
3300026187|Ga0209929_1049681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1194Open in IMG/M
3300026420|Ga0247581_1086071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium506Open in IMG/M
3300026437|Ga0247577_1093865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium607Open in IMG/M
3300026447|Ga0247607_1013725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1309Open in IMG/M
3300026449|Ga0247593_1050238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium823Open in IMG/M
3300026465|Ga0247588_1009596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1740Open in IMG/M
3300026471|Ga0247602_1030736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1519Open in IMG/M
3300026500|Ga0247592_1112357Not Available654Open in IMG/M
3300026503|Ga0247605_1034632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1264Open in IMG/M
3300026504|Ga0247587_1144508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium585Open in IMG/M
3300026506|Ga0228604_1034367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium773Open in IMG/M
3300027687|Ga0209710_1205508Not Available667Open in IMG/M
3300027752|Ga0209192_10128014All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. 63ED37-21022Open in IMG/M
3300027780|Ga0209502_10169349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1032Open in IMG/M
3300027780|Ga0209502_10452838Not Available514Open in IMG/M
3300027788|Ga0209711_10264843Not Available759Open in IMG/M
3300027791|Ga0209830_10130101All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. 63ED37-21223Open in IMG/M
3300027833|Ga0209092_10140436Not Available1400Open in IMG/M
3300028109|Ga0247582_1198609Not Available507Open in IMG/M
3300028110|Ga0247584_1141613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium594Open in IMG/M
3300028130|Ga0228619_1122611Not Available598Open in IMG/M
3300028233|Ga0256417_1210122Not Available520Open in IMG/M
3300028279|Ga0228613_1116119Not Available627Open in IMG/M
3300028280|Ga0228646_1049523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1041Open in IMG/M
3300028282|Ga0256413_1116973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium968Open in IMG/M
3300028284|Ga0257120_1086150Not Available706Open in IMG/M
3300028287|Ga0257126_1061658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1490Open in IMG/M
3300028290|Ga0247572_1029531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1252Open in IMG/M
3300028297|Ga0228617_1088078Not Available782Open in IMG/M
3300028333|Ga0247595_1022392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1010Open in IMG/M
3300028391|Ga0233394_1057680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium897Open in IMG/M
3300028418|Ga0228615_1043859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1379Open in IMG/M
3300031851|Ga0315320_10373105Not Available997Open in IMG/M
3300032047|Ga0315330_10304438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1004Open in IMG/M
3300032073|Ga0315315_10922302Not Available788Open in IMG/M
3300032088|Ga0315321_10628372Not Available633Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater34.82%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine16.07%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine8.93%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.04%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater7.14%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.36%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.57%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.68%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.68%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.79%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine1.79%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.79%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.79%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.89%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.89%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.89%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000224Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10mEnvironmentalOpen in IMG/M
3300001349Pelagic Microbial community sample from North Sea - COGITO 998_met_10EnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001941Marine microbial communities from Browns Bank, Gulf of Maine - GS003EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300004280Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100mEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005747Seawater microbial communities from Vineyard Sound, MA, USA - control T14EnvironmentalOpen in IMG/M
3300007280Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ18 time pointEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300022931 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MGEnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024191Seawater microbial communities from Monterey Bay, California, United States - 45DEnvironmentalOpen in IMG/M
3300024230Seawater microbial communities from Monterey Bay, California, United States - 48DEnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024235Seawater microbial communities from Monterey Bay, California, United States - 79DEnvironmentalOpen in IMG/M
3300024237Seawater microbial communities from Monterey Bay, California, United States - 65DEnvironmentalOpen in IMG/M
3300024244Seawater microbial communities from Monterey Bay, California, United States - 125D_rEnvironmentalOpen in IMG/M
3300024248Seawater microbial communities from Monterey Bay, California, United States - 48D_rEnvironmentalOpen in IMG/M
3300024293Seawater microbial communities from Monterey Bay, California, United States - 63DEnvironmentalOpen in IMG/M
3300024314Seawater microbial communities from Monterey Bay, California, United States - 70DEnvironmentalOpen in IMG/M
3300024321Seawater microbial communities from Monterey Bay, California, United States - 31DEnvironmentalOpen in IMG/M
3300024328Seawater microbial communities from Monterey Bay, California, United States - 44DEnvironmentalOpen in IMG/M
3300024415Seawater microbial communities from Monterey Bay, California, United States - 76DEnvironmentalOpen in IMG/M
3300025658Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025876Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026437Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 34R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026506Seawater microbial communities from Monterey Bay, California, United States - 4DEnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028130Seawater microbial communities from Monterey Bay, California, United States - 22DEnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028280Seawater microbial communities from Monterey Bay, California, United States - 58DEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028284Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10EnvironmentalOpen in IMG/M
3300028287Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120mEnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028297Seawater microbial communities from Monterey Bay, California, United States - 18DEnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028391Seawater microbial communities from Monterey Bay, California, United States - 24DEnvironmentalOpen in IMG/M
3300028418Seawater microbial communities from Monterey Bay, California, United States - 16DEnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SI34jun09_10mDRAFT_100997033300000224MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKAAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGNFD*
JGI20160J14292_1009401413300001349Pelagic MarineMSLSKKINDIISKNEEVYWNNEFQIQLHMSKKFLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLS
JGI20155J14468_1023424213300001354Pelagic MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGNF
JGI20158J14315_1017740813300001355Pelagic MarineMSLSKKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKTAAIIESGEFDETFPPPTHVVADLSADKIDNHDMFIEDFFEVITKLSKGLTMSNGDFD*
GOS2219_101669653300001941MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLRMSNGDFD*
Ga0055584_10035080323300004097Pelagic MarineMSLLDKVNIIISSNEEVYWYNEFQIQLYMSKKYLEAFKEAALIECGEFDENFPPPTHIVADLAENFIKDHDLFLSDFFEAIQILSKGLKLNVHKL*
Ga0055584_10264577323300004097Pelagic MarineMSLSKKINDIISKNEEVYWNNEFQIQLHMSKKFLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD*
Ga0066605_1003678233300004279MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKAAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD*
Ga0066606_1010065223300004280MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD*
Ga0073579_128318613300005239MarineMSLYDKINKIISKNEEVYWNNEFQIQLYMSRKHLSAFKAAAIIESGEFDEKFPPPTHIVADLGLDQIADHNLFVDQFYEVIIKLSKGLTMLNGDFE*
Ga0076924_116515273300005747MarineMSLLDKVNIIISSNEEVYWNNEFQIQLYMSKKYLEAFKEAALIECGEFDENFPPPTHIVADLAKNFIKDHDLFLSDFFEAIQILSKGLKLNVHKL*
Ga0101452_12491143300007280Marine Surface WaterMSLSEKINDIISKNEEVYWNNEFQIQLHMSKKFLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD*
Ga0102963_100059383300009001Pond WaterMSLLDKVNIIISSNEEVYWYNEFQIQLYMSKKYLEAFKEAALIECGEFDENFPPPTHIVADLAKNFIKDHDLFLSDFFEAIQILSKGLKLNVHKL*
Ga0102854_116924413300009058EstuarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKAAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVIT
Ga0115566_1073744113300009071Pelagic MarineMLLSETINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLVADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD*
Ga0114995_1025337713300009172MarineMSLYDKITKIISKNEEVYWNNEFQIQLYMSRKHLSAFKAAAIIESGEFDEKFPPPTHIVADLGADQIADHNLFVDQFYEVITKLSKGSTMFNGDFE*
Ga0115562_120290323300009434Pelagic MarineMSLSKKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKAAAIIESGEFDKTFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGDFN*
Ga0115008_1017610733300009436MarineMLLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGDFD*
Ga0115563_103736323300009442Pelagic MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKAAAIIESGEFDKTFPPPTHIVADLGADKIDNHEMFIEEFFEVITKLSKGLTMYNGDFN*
Ga0115565_1009523413300009467Pelagic MarineMSLSKKINDIISKNEEVYWNNEFQIQLHMSKKFLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSN
Ga0115565_1027411023300009467Pelagic MarineMSLSEKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKAAAIIESGEFDKTFPPPTHIVADLGADKIDNHEMFIEEFFEVITKLSKGLTMSNGDFN*
Ga0115554_129775113300009472Pelagic MarineNEEVYWNNEFQIQLHMSKKFLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD*
Ga0115571_104387443300009495Pelagic MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGNFD*
Ga0115571_110474613300009495Pelagic MarineMLLSEKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKAAAIIESGEFDKTFPPPTHIVADLGADKIDNHEMFIEEFFEVITKLSKGLTMSNGDFN*
Ga0115569_1016676623300009497Pelagic MarineMSLSKKINEIISKNEEVYWNNEFQIQLHMSKKFLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD*
Ga0115569_1029697413300009497Pelagic MarineMSLSKKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGL
Ga0115568_1040817313300009498Pelagic MarineMSLSKKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKTAAIIESGEFDETFPPPTHVVADLSADKIDNHDMFIEDFFEVITKLSKGLTMSNGDFN*
Ga0115572_1002785553300009507Pelagic MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMCNGDFD*
Ga0115572_1027137133300009507Pelagic MarineMSLSKKINDIISKNEEVYWNNEFQIQLHMSKKFLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD*
Ga0115572_1032339413300009507Pelagic MarineKSMSLSKKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKAAAIIESGEFDKTFPPPTHIVADLGADKIDNHEMFIEEFFEVITKLSKGLTMSNGDFN*
Ga0115567_1008476913300009508Pelagic MarineIISKNEEVYWNNEFQIQLHMSKKFLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD*
Ga0115567_1090048413300009508Pelagic MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGN
Ga0206125_1004348543300020165SeawaterMSLSKKINDIISKNEEVYWNNEFQIQLHMSKKFLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0211504_102161143300020347MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGDFD
Ga0211505_107343523300020352MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGDFG
Ga0211677_1001179543300020385MarineMSLSDEVNKIISKNEEVYWNNEFQIQLHLSRRWLDAFKETAIIEAGEFDETFPPPVHVVADLGEEKISDHDLFLKQLF
Ga0211678_1011909813300020388MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0206677_1009340333300021085SeawaterMSLYNKISEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0206677_1018532433300021085SeawaterMSLSNKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFDVITKLSKG
Ga0206687_174279323300021169SeawaterMSLYNKISEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIDDFFEVITKLSKGLTMSNGDFD
Ga0206682_1008278023300021185SeawaterMSLSNKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFDVITKLSKGLTMSNGDFE
Ga0206682_1016639533300021185SeawaterNKISEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIDDFFEVITKLSKGLTILMVILTKKRD
Ga0206692_122932733300021350SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0206123_1020496513300021365SeawaterGKPMSLSKKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKAAAIIESGEFDKTFPPPTHIVADLGADKIDNHEMFIEEFFEVITKLSKGLTMSNGDFN
Ga0206123_1036486623300021365SeawaterKSMSLSKKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKTAAIIESGEFDETFPPPTHVVADLSADKIDNHDMFIEDFFEVITKLSKGLTMSNGDFD
Ga0213863_1003517353300021371SeawaterMSLSKKINEIISKNEEVYWNNEFQIQLNMSKKYLLAFKTAAIIESGEFDETFPPPTHVVADLSADKIDNHDMFIEDFFEVITKLSKGLTMSNGDFD
Ga0213863_1024142423300021371SeawaterMSLSNKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFDVITKLSKGLTMSNGDFD
Ga0213863_1039375313300021371SeawaterMSLSKKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKAAAIIESGEFDKTFPPPTHIVADLGADKIDNHEMFIEEFFEVITKLSKGLTMSNGDFN
Ga0222717_1011500413300021957Estuarine WaterLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0222718_1003861733300021958Estuarine WaterMSLLDKVNIIISSNEEVYWYNEFQIQLYMSKKYLEAFKEAALIECGEFDENFPPPTHIVADLAENFIKDHDLFLSDFFEAIQILSKGLKLNVHKL
(restricted) Ga0233426_1002615643300022920SeawaterMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGNFD
(restricted) Ga0233426_1007440033300022920SeawaterMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKAAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
(restricted) Ga0233426_1009445223300022920SeawaterMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFNKTFPPPTHVVADLGADKIDNHNMFIEDFFEIITKLSKGLTMSNGDFD
(restricted) Ga0233433_1002977743300022931SeawaterMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0228683_100611623300023694SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFDVITKLSKGLTMSNGNFD
Ga0228636_105544323300024191SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPSTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0228638_109314323300024230SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDKTFPPSTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0228638_113709323300024230SeawaterMSLSNKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0233399_106761323300024231SeawaterMSLYNKISEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPSTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0228665_111852413300024235SeawaterMSLSNKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFDVIIKLSKGLTMSNGDFD
Ga0228653_107118213300024237SeawaterKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPSTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0228678_107146633300024244SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDKTFPPSTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTISNCDFE
Ga0228676_111104023300024248SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIDDFFEVITKLSKGLTMSNGDFD
Ga0228651_113673813300024293SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIDDFFEVITK
Ga0228657_109589823300024314SeawaterMSLYNKISEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFDVITKLSKGLTMSNGDFD
Ga0228626_108536423300024321SeawaterLGKSMSLYNKISEIISKNEEVYWNNEFQIQLHMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFDVITKLSKGLTMSNGDFD
Ga0228635_111066723300024328SeawaterMSLSNKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPSTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFE
Ga0228662_105364833300024415SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPSTHIVADLGADKIDNHNMFIEDFFDVITKL
Ga0209659_110633413300025658MarineEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGNFD
Ga0209715_109426323300025699Pelagic MarineMSLSKKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLVADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0209603_102185853300025849Pelagic MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMCNGDFD
Ga0209223_1032113013300025876Pelagic MarineSMSLSKKINDIISKNEEVYWNNEFQIQLHMSKKFLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0209534_1039428813300025880Pelagic MarineMSLSKKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKAAAIIESGEFDKTFPPPTHIVADLGADKIDNHEMFIEEFFEVITKLSKGLTMYNGDFN
Ga0209632_1016110413300025886Pelagic MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMCNGD
Ga0209631_1040981213300025890Pelagic MarineMSLSKKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKTAAIIESGEFDETFPPPTHVVADLSADKIDNHDMFIEDFFEVITKLSKGLTMSNGDFD
Ga0209335_1034209413300025894Pelagic MarineGKSMSLSKKINEIISKNEEVYWNNEFQIQLYMSKKYLLAFKTAAIIESGEFDETFPPPTHVVADLSADKIDNHDMFIEDFFEVITKLSKGLTMSNGDFD
Ga0209929_104968123300026187Pond WaterMSLLDKVNIIISSNEEVYWYNEFQIQLYMSKKYLEAFKEAALIECGEFDENFPPPTHIVADLAKNFIKDHDLFLSDFFEAIQILSKGLKLNVHKL
Ga0247581_108607113300026420SeawaterKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0247577_109386513300026437SeawaterWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPSTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0247607_101372533300026447SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDKTFPPSTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0247593_105023813300026449SeawaterMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPSTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0247588_100959623300026465SeawaterMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFLPPTHIVADLGADKIDNHNMFIDDFFEVITKLSKGLTMSNGDFD
Ga0247602_103073633300026471SeawaterMSLYNKISEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPSTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0247592_111235713300026500SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPSTHIVADLGADKIDNHNMFIDDFFEVITKLSKGLTMSNGDFD
Ga0247605_103463223300026503SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0247587_114450813300026504SeawaterSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0228604_103436713300026506SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDKTFPPSTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0209710_120550813300027687MarineMSLYDKITKIISKNEEVYWNNEFQIQLYMSRKHLSAFKAAAIIESGEFDEKFPPPTHIVADLGADQIADHNLFVDQFYEVITKLSKGSTMFNGDFE
Ga0209192_1012801433300027752MarineLLYDKINKIISKNEEVYWNNEFQIQLYMSRKHLSAFKAAAIIESGEFDEKFPPPTHIVADLGSDQIADHNLFVDQFYEVIIKLSKGLTMLNGDFE
Ga0209502_1016934913300027780MarineLLYDKINKIISKNEEVYWNNEFQIQLYMSRKHLSAFKAAAIIESGEFDEKFPPPTHIVADLGSDQIADHNLFVDQFYEVIIKLSKGLRMSNGDFE
Ga0209502_1045283813300027780MarineMSLYDKITKIISKNEEVYWNNEFQIQLYMSRKHLSAFKAAAIIESGEFDEKFPPPTHIVADLGADQIADHNLFVDQFYEVITKLSKGSTMFN
Ga0209711_1026484313300027788MarineKKXKVNKSMSLYDKITKIISKNEEVYWNNEFQIQLYMSRKHLSAFKAAAIIESGEFDEKFPPPTHIVADLGADQIADHNLFVDQFYEVITKLSKGSTMFNGDFE
Ga0209830_1013010123300027791MarineMLLYDKINKIISKNEEVYWNNEFQIQLYMSRKHLSAFKAAAIIESGEFDEKFPPPTHIVADLGADQIADHNLFVDQFYEVITKLSKGSTMFNGDFE
Ga0209092_1014043623300027833MarineMLLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0247582_119860913300028109SeawaterMSLSNKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFDVITKLSKGLTMSN
Ga0247584_114161313300028110SeawaterKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPSTHIVADLGADKIDNHNKFIEEFFEVITKLSKGLTMSNGDFD
Ga0228619_112261113300028130SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDKTFPPPTHIVADLGADKIDNHTMFIEEFFDVITKLSKGLTMSNGDFD
Ga0256417_121012223300028233SeawaterMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKFLLAFKTTAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLTMS
Ga0228613_111611933300028279SeawaterMSLYNKISEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPSTHIVADLGADKIDNHNMFIEDFF
Ga0228646_104952333300028280SeawaterSLSNKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0256413_111697313300028282SeawaterEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDKTFPPSTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0257120_108615033300028284MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVI
Ga0257126_106165823300028287MarineMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKAAAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGNFD
Ga0247572_102953123300028290SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIKDFFEVITKLSKGLTMSNGDFD
Ga0228617_108807813300028297SeawaterMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHTMFIEEFFDVIT
Ga0247595_102239223300028333SeawaterLNLGKSMSLYNKITEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0233394_105768013300028391SeawaterGKSMSLSNKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEDFFDVITKLSKGLTMSNGDFD
Ga0228615_104385933300028418SeawaterMSLSNKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFDVITKLSKGLTMSNGDFD
Ga0315320_1037310513300031851SeawaterMSLSEKINEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVI
Ga0315330_1030443823300032047SeawaterWNLGKSMSLYNKISEIISKNEEVYWNNEFQIQLHMSKKYLLAFKTTAIIESGEFDETFPPPTHIVADLGADKIDNHNMFIEEFFEVITKLSKGLTMSNGDFD
Ga0315315_1092230233300032073SeawaterMSLSDKINKIISKNEEVYWNNEFQIQLHLSRRWLDAFKEAAIIEAGEFDETFPPPVHVVADLSENKISNHELFLEQFFEVIQNLSKGMILSNGEF
Ga0315321_1062837213300032088SeawaterMSLYNKISEIISKNEEVYWNNEFQIQLHMSKKYLLAFKATAIIESGEFDKTFPPPTHVVADLGADKIDNHNMFIEEFFDVIIKLSKGLTMSNGDFD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.