Scaffold Ga0077123_117150

Overview

Basic Information

• Taxon OID: 3300005745
• Scaffold ID: Ga0077123_117150
• Source Dataset Name: Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS844
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2379
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Diffuse Flow Fluid → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Mid-Cayman Rise
• Coordinates
  • Lat. (^o): 18.374735
  • Long. (^o): -81.797326
  • Depth (m): 2376

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079616	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0077123_1171504	F079616	AGAAG	MENTFEIGEVVVCVNARRNWYKLGGLKKDEMYTVVGYNPYDNGLILKEVKSPGSGYNAFAAERFRKVDYNFAENVLEDLQPQIISEVSPKNFIKSNLN*