NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005745

3300005745: Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS844



Overview

Basic Information
IMG/M Taxon OID3300005745 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114926 | Gp0118608 | Ga0077123
Sample NameMicrobial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS844
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size95261731
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1
Not Available1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Diffuse Flow Fluid → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMid-Cayman Rise
CoordinatesLat. (o)18.374735Long. (o)-81.797326Alt. (m)N/ADepth (m)2376
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013484Metagenome / Metatranscriptome271Y
F079616Metagenome115Y
F097602Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0077123_102817All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1488Open in IMG/M
Ga0077123_109126Not Available2594Open in IMG/M
Ga0077123_117150All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia2379Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0077123_102817Ga0077123_1028172F097602VTILPGEGPSALGRSNYDSLSPKRCSNADVMNRGSADEAVVIVKFGADEFMVTWRRIKHRISGRKLEVKGGTRKRSRPLIIDWWFEISLT*
Ga0077123_109126Ga0077123_1091262F013484MDIHLEFSGRTLSTEHQAIVDALNEFLAWLPDGEDPNAALRLAMMILEAANVAPQAVLAQAVGFGQDRSVRVYKQRLREEGLSGLFDHPIPGRPALTTKTEVEKALLRVILSAVIEEHALPDDVTLAEGVNRILREAQEPEAGHVTASMIEAIRLRWGIQRPTLVRQLQATQLAATAERAQMRLGQTRVGGAFILAVLLVETGWLKLAYLLPMAANYAVTAVQWLLTAIFAVIFGVQRAFHLDDVRDIGFALVTGRPRPLTHGTFQHLLHAIPKEKAQAFYAASAQLEVQALGEGPRRISLDGHNLPRYTRLVDLPKGKIGNTGRILKAEELVLAYDLDAHLWLALRVYRGTKKLSQGLVEMVREILKHRGDIPGRLRVFFDKGGYSGQIFRDLAEESQVRFYTPAVRYPANVELWEQLKDSDFDPEPFAFDKHADLPPDQRPVYRLADTEMTLNVRADRKVVDTVTLRAIVLHDPQGEKPAERWPVVFLTDDRDIDARALLNEFGDHWGQEFAHRIGKHDLCLDILPPGYVLKTRQDEQGQQVREVEYDNTAFFLSAWLRCLVFNLMTCFAQAMGREYSKMWAGTLLRKFIRRPATLYLVGKELHVVFDPFPGQDELQPLLDKLNAKRTALPWLNNLVVQFSIAQDEPLHPLTEPEKRNRLFGDD*
Ga0077123_117150Ga0077123_1171504F079616MENTFEIGEVVVCVNARRNWYKLGGLKKDEMYTVVGYNPYDNGLILKEVKSPGSGYNAFAAERFRKVDYNFAENVLEDLQPQIISEVSPKNFIKSNLN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.