| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005745 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114926 | Gp0118608 | Ga0077123 |
| Sample Name | Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS844 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Marine Biological Laboratory |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 95261731 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Diffuse Flow Fluid → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Mid-Cayman Rise | |||||||
| Coordinates | Lat. (o) | 18.374735 | Long. (o) | -81.797326 | Alt. (m) | N/A | Depth (m) | 2376 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013484 | Metagenome / Metatranscriptome | 271 | Y |
| F079616 | Metagenome | 115 | Y |
| F097602 | Metagenome / Metatranscriptome | 104 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0077123_102817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 1488 | Open in IMG/M |
| Ga0077123_109126 | Not Available | 2594 | Open in IMG/M |
| Ga0077123_117150 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia | 2379 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0077123_102817 | Ga0077123_1028172 | F097602 | VTILPGEGPSALGRSNYDSLSPKRCSNADVMNRGSADEAVVIVKFGADEFMVTWRRIKHRISGRKLEVKGGTRKRSRPLIIDWWFEISLT* |
| Ga0077123_109126 | Ga0077123_1091262 | F013484 | MDIHLEFSGRTLSTEHQAIVDALNEFLAWLPDGEDPNAALRLAMMILEAANVAPQAVLAQAVGFGQDRSVRVYKQRLREEGLSGLFDHPIPGRPALTTKTEVEKALLRVILSAVIEEHALPDDVTLAEGVNRILREAQEPEAGHVTASMIEAIRLRWGIQRPTLVRQLQATQLAATAERAQMRLGQTRVGGAFILAVLLVETGWLKLAYLLPMAANYAVTAVQWLLTAIFAVIFGVQRAFHLDDVRDIGFALVTGRPRPLTHGTFQHLLHAIPKEKAQAFYAASAQLEVQALGEGPRRISLDGHNLPRYTRLVDLPKGKIGNTGRILKAEELVLAYDLDAHLWLALRVYRGTKKLSQGLVEMVREILKHRGDIPGRLRVFFDKGGYSGQIFRDLAEESQVRFYTPAVRYPANVELWEQLKDSDFDPEPFAFDKHADLPPDQRPVYRLADTEMTLNVRADRKVVDTVTLRAIVLHDPQGEKPAERWPVVFLTDDRDIDARALLNEFGDHWGQEFAHRIGKHDLCLDILPPGYVLKTRQDEQGQQVREVEYDNTAFFLSAWLRCLVFNLMTCFAQAMGREYSKMWAGTLLRKFIRRPATLYLVGKELHVVFDPFPGQDELQPLLDKLNAKRTALPWLNNLVVQFSIAQDEPLHPLTEPEKRNRLFGDD* |
| Ga0077123_117150 | Ga0077123_1171504 | F079616 | MENTFEIGEVVVCVNARRNWYKLGGLKKDEMYTVVGYNPYDNGLILKEVKSPGSGYNAFAAERFRKVDYNFAENVLEDLQPQIISEVSPKNFIKSNLN* |
| ⦗Top⦘ |