Scaffold Ga0074229_102618

Overview

Basic Information

• Taxon OID: 3300005697
• Scaffold ID: Ga0074229_102618
• Source Dataset Name: Human fecal microbial communities J Craig Venter Institute, Maryland, USA - Subject 8
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 847
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The State University Of New York At Buffalo, New York, Usa, Of Three Healthy Adults

Source Dataset Sampling Location

• Location Name: J Craig Venter Institute, Rockville, Maryland, USA
• Coordinates
  • Lat. (^o): 39.134321
  • Long. (^o): -77.181702

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067844	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0074229_1026181	F067844	N/A	ASVWYLILNRKLQTLPIYITQLSSHLPRPLTMGTQQVSAGAAVITPQHRSYRVPQGSPQVFGGP*