3300005697: Human fecal microbial communities J Craig Venter Institute, Maryland, USA - Subject 8

Overview

Basic Information

• IMG/M Taxon OID: 3300005697
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0056641 | Gp0051096 | Ga0074229
• Sample Name: Human fecal microbial communities J Craig Venter Institute, Maryland, USA - Subject 8
• Sequencing Status: Finished
• Sequencing Center: J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 20492925
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Communities From The State University Of New York At Buffalo, New York, Usa, Of Three Healthy Adults
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The State University Of New York At Buffalo, New York, Usa, Of Three Healthy Adults

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: J Craig Venter Institute, Rockville, Maryland, USA
• Coordinates
  • Lat. (^o): 39.134321
  • Long. (^o): -77.181702
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067844	Metagenome	125	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0074229_102618	Not Available	847

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074229_102618	Ga0074229_1026181	F067844	ASVWYLILNRKLQTLPIYITQLSSHLPRPLTMGTQQVSAGAAVITPQHRSYRVPQGSPQVFGGP*