Scaffold Ga0074427_106851

Overview

Basic Information

• Taxon OID: 3300005678
• Scaffold ID: Ga0074427_106851
• Source Dataset Name: Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91307 Phage Sequencing
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Queensland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 711
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Source Dataset Sampling Location

• Location Name: St. Lucia, Queensland Australia
• Coordinates
  • Lat. (^o): -27.49999
  • Long. (^o): 153.012098

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095570	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074427_1068511	F095570	N/A	IIMTEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA*