NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074422_134801

Scaffold Ga0074422_134801


Overview

Basic Information
Taxon OID3300005673 Open in IMG/M
Scaffold IDGa0074422_134801 Open in IMG/M
Source Dataset NameEnhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90401 Phage Sequencing
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Queensland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)558
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Source Dataset Sampling Location
Location NameSt. Lucia, Queensland Australia
CoordinatesLat. (o)-27.49999Long. (o)153.012098Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096508Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0074422_1348013F096508GGAMKKKRIKPADLIKLLDRHNLQKYDICKICGVSAATAERYIKYGPPEAQYRLIQLSLGDL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.