3300005673: Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90401 Phage Sequencing

Overview

Basic Information

• IMG/M Taxon OID: 3300005673
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111422 | Gp0115857 | Ga0074422
• Sample Name: Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90401 Phage Sequencing
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Queensland
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 51929904
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: St. Lucia, Queensland Australia
• Coordinates
  • Lat. (^o): -27.49999
  • Long. (^o): 153.012098
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096508	Metagenome / Metatranscriptome	104	N
F100051	Metagenome / Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0074422_102506	Not Available	1441
Ga0074422_134801	Not Available	558

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074422_102506	Ga0074422_1025064	F100051	RLICAVFGHRYVVERVLNHGARKVGCTRCGKHWGMHDGTRSFVPWDGELEALYAPGGILAQASGDVPPNAKVSGAGTASAGLPG*
Ga0074422_134801	Ga0074422_1348013	F096508	MKKKRIKPADLIKLLDRHNLQKYDICKICGVSAATAERYIKYGPPEAQYRLIQLSLGDL*