NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073582_115818

Scaffold Ga0073582_115818


Overview

Basic Information
Taxon OID3300005663 Open in IMG/M
Scaffold IDGa0073582_115818 Open in IMG/M
Source Dataset NameMarine sediment microbial community near Loki's castle
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUppsala University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2881
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Community From Loki's Castle, Arctic Ocean

Source Dataset Sampling Location
Location NameLoki's castle hydrothermal vent
CoordinatesLat. (o)73.763167Long. (o)8.464Alt. (m)Depth (m).74
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060593Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0073582_1158181F060593N/AMTYSRIPESDYLKLLFQLRGQMAAILNVFNCYGLNNDVTQAVGECVKVAENFGMALRGKSTPIHILTKPKRRVLEDED*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.