| Basic Information | |
|---|---|
| Taxon OID | 3300005627 Open in IMG/M |
| Scaffold ID | Ga0077107_104844 Open in IMG/M |
| Source Dataset Name | Crenothrix polyspora biofilm communities from Wolfenbuettel waterworks, Germany |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 803 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Crenothrix Polyspora → Crenothrix Polyspora Biofilm Communities From Wolfenbuettel Waterworks, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Wolfenb?ttel, Lower Saxony | |||||||
| Coordinates | Lat. (o) | 52.149 | Long. (o) | 10.542 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007831 | Metagenome / Metatranscriptome | 344 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0077107_1048441 | F007831 | GAGG | MMILVAVMFLLPPVLGTLYLYVSGVFINRRTFQFVFYTLLAFFALTIGISTQFSYQGYDRLATTPVSLLPVLPEP* |
| ⦗Top⦘ |