Scaffold Ga0070727_10036134

Overview

Basic Information

• Taxon OID: 3300005590
• Scaffold ID: Ga0070727_10036134
• Source Dataset Name: Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3071
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate

Source Dataset Sampling Location

• Location Name: Atlantic Coast
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030288	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070727_100361345	F030288	GAGG	MERLAEIDLSQNNRIAWCERLLMLIVVLQFPQLATLVM*